SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|122846|e_gw1.42.378.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|122846|e_gw1.42.378.1
Domain Number 1 Region: 10-203
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-39
Family Nuclear receptor ligand-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|122846|e_gw1.42.378.1
Sequence length 207
Sequence
MLDKLPSNPTEFANIAEGFVRRIIKVTKHIVNFKKLCKDDQICLLKGAVVDVMMLRSAVN
YDPSTESWSLSTMSYDSNRISADILKCGGRETMEMFKSYSKFIKSLMSTIRGDLLMLKIL
IVMAIFSTDRGDLVDSGFVQKIQEEYAEILQKYIQSRFPEEKTLFAQVVMKLTDLRNIND
VHTKMLLKMRVEDVEPLLIEIFDLPCP
Download sequence
Identical sequences V4BP31
XP_009058681.1.39240 jgi|Lotgi1|122846|e_gw1.42.378.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]