SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|138118|e_gw1.122.41.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|138118|e_gw1.122.41.1
Domain Number 1 Region: 182-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000119
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 30-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000798
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 131-269
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 347-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 68-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 260-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 1-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000822
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|138118|e_gw1.122.41.1
Domain Number - Region: 306-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|138118|e_gw1.122.41.1
Sequence length 389
Sequence
MNGGQCVPVGEDILCNCPIGYSGSQCEIPYDLCQPNPCFNNGSCFQDAGGYNCACYDYFR
GDQCETYISPCAKTSCFNGGSCLDEGYGIFQCYCLHNFTGELCDIKLDYCESNPCLNGMC
KNEEYGYVCDCAHGYAGRNCDVAINYNCRHVDCQNNGRCIENEEGPSCSCVRGYSGIRCE
VNVDDCSSSPCKNSATCVDGYDEYMCRCIPGFGGRHCEEDINECMEWKRCTENNRICIDR
PRGYDCVCNSGFTGMNCHDPIDECVHMNCLNGGYCEDGYGINDAICVCPKGFSGTESNCD
VLYKSGCELSPCLTNATCIPDILSLEGFRCECPESNVPYDKNCKPLPCVFSPCLNNGICY
DNYDASFTCQCVGGFSGTHCETAQVIGKS
Download sequence
Identical sequences V4AEW1
XP_009046714.1.39240 jgi|Lotgi1|138118|e_gw1.122.41.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]