SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|153999|fgenesh2_pg.C_sca_5000039 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|153999|fgenesh2_pg.C_sca_5000039
Domain Number 1 Region: 258-306
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000196
Family Elafin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 219-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.03
Further Details:      
 
Domain Number 3 Region: 151-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000664
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|153999|fgenesh2_pg.C_sca_5000039
Domain Number - Region: 184-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000133
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 309-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.00377
Family VWC domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|153999|fgenesh2_pg.C_sca_5000039
Sequence length 723
Sequence
MPCIIMIGFNIGIFLALVYVAKGEIHHQKKLNLCNSCSADDRNCTRKIKVPCLDFRERRD
LGFNHNYNGSLYKKKRRRFTQGKRRKIWLFDGNSHRNMKSDYHLGRYSEQCEKEETYTCR
YFKCYEVCCSGWVMEPINNTCSIYDSFPTELHCKNGGEEILTVDGPVCVCPASFTGKNCE
TNLCDLNCLNEGLCDYVDGAARCVCQKGFKGKLCEKHFCSGGCQNDGRCVIDEGIFAKPF
CVCPPKYSGKYCEKSDYEPKPGVCPRVHNQMLVNVGVCTNTCYDDDGCQGQHKCCSTGCG
SSCMMPADQFCVWNKTEYTIGEHFKPNACTVCTCYIPDSRRSYGGARCESLPCPTLNCNM
IETGECCDVCVDDIFPVKPISYEEPRFVNCPATTLVLVLELDESSVHLPIKLEALDYMTN
RLDVFYTRTIFEAGKGPTNFHTVTATSSTDRFGQFAVCIFQIRVKDRQPPAFDYCPSTIK
TTKQIVEWNTPIARDNVGLAVKPVSRSKPGEKFKYGDHAIVYKTEDYEGNVANCIFFVKV
FPPKILGKRNRPSRLLFSPHNINMFIIGISAFGVVILAIVSITMVWYKSKRSGGEVIPNR
LSTIPTGPRASQNIYSVSDAREPPPAYEITPLKKTLMVETDLTASPTSSQIDFIDEASTS
RTNLCSPVDSSTRPKISITSHTTNPLYQNMLDKLFYCIDKDNGNCLSSLAVLVLKNHLVE
RKE
Download sequence
Identical sequences V3ZX43
jgi|Lotgi1|153999|fgenesh2_pg.C_sca_5000039 XP_009059982.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]