SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158109|fgenesh2_pg.C_sca_16000077 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158109|fgenesh2_pg.C_sca_16000077
Domain Number 1 Region: 367-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000888
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 2 Region: 405-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000213
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158109|fgenesh2_pg.C_sca_16000077
Sequence length 747
Sequence
MDTRRRTTSFFILISLGMLVVNTEGLETDHWGTQFIFSFIYPMHHNSKNIIAITAREVTK
VRVIFQETQAVVKLTVQPGQTNHTWLDQIVIIATENDTSVTVSFKGFVQCINIGAQNNLQ
FSMDAYDVMNVFCNSDTSGTLITSSKPIAVITGSRQLQLHNFYVRGVVMEMLPPTTEFGT
EFVFVTPHGHTGGTSIRIISEFGWQTTIFNNIYSNTPRQPSDIIINPGTYLCFTTSQPVL
VVVFMTARTSYQYPTDTGNAYMMVIPPVTKFSNQYVIPMDIFGQYGYNNYYNRVDVIGKS
PVNGLVPALPYFDMCPGYEASSSTVSLSGTIEFTANSQFIVLVYGFIYRDAFGFPGGMKL
TDFSGTEECSSSPCLNEGWCVETALSYKCHCSDTRYTGQHCETDTVNDCDPNPCIFGICN
DLSGFYTCSCHIGYIGYNCSTATPGQTTIATTTQEQTPIKSTTQEQTTTATTTQEHTTLD
TTTQGQTTIATTTHEQTTLDTTTQEQTTQETTTQEQITIVTTTQKQTSLDSTAQEQTTLE
TTTQEQTSLATTTQKQTSLDTTAQEQTTLETTTQEQATIATTTQETTTLETTTQEQTTQE
TTTQEQTTQEQTTTTSLATTLTFTPTRIYMRKQFCKGDLCMCKCPCIKKLTTAQIAEDAI
NTVNALKVETSTLSKTVRKKISSENLTKTETNLGVTSVIFVSSVFFVIIFMDISKMIYWI
STKLTKRTNRIHVDPENETGSTEEGND
Download sequence
Identical sequences V4ARS9
jgi|Lotgi1|158109|fgenesh2_pg.C_sca_16000077 XP_009049387.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]