SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|159725|fgenesh2_pg.C_sca_21000195 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|159725|fgenesh2_pg.C_sca_21000195
Domain Number 1 Region: 55-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000437
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|159725|fgenesh2_pg.C_sca_21000195
Domain Number - Region: 129-178
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00018
Family Pan module (APPLE domain) 0.032
Further Details:      
 
Domain Number - Region: 7-56
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00377
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number - Region: 165-223
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0827
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|159725|fgenesh2_pg.C_sca_21000195
Sequence length 241
Sequence
MTRLFIGCDNYKIPLNFEWLSRVSCEDNKRYKCPEGYQDEVRTICTNGNWFLKPTCTDID
ECATNNGLCEDKCQNQPGSYNCSCPVGSELQENGLCCGPPPGTVATVSFFLEFYRCTLQV
QKEETQLGYSVNIKTMHTGAENKLECEEKYNNTINCTAWSVINRVCRLFGSPVILLEKNP
DMTLEKCKEFCVQKKKYASAEWYIYYARCALFDSKQTEFHDYGGDDEAKTLVFTKVDVNC
V
Download sequence
Identical sequences V4AIX1
XP_009052464.1.39240 jgi|Lotgi1|159725|fgenesh2_pg.C_sca_21000195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]