SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162352|fgenesh2_pg.C_sca_33000164 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162352|fgenesh2_pg.C_sca_33000164
Domain Number 1 Region: 91-354
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-80
Family Nuclear receptor ligand-binding domain 0.00000000831
Further Details:      
 
Domain Number 2 Region: 39-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162352|fgenesh2_pg.C_sca_33000164
Sequence length 359
Sequence
MHSPPLHSPTSSMGSPPLMSLGCPSPTGMQPHTTLSNKHICAICGDRASGKHYGVYSCEG
CKGFFKRTVRKELTYACRDDKNCYIDKRQRNRCQYCRYMKCLAMGMKREAVQEERQRTKE
KGEEVESTSSVNNDMPVEQILEAELTVEPKIDTYIDTRNDPVARICHAADKQLFTLVDWA
KRIPHFTELPLEDQVIQLRAGWNELLIAGFSHRSIAVKDGILLSTGLHVHRSSARDAGVG
TIFDRVLTELVAKMREMKMDKTELGCLRAIVLFNPDAKGLTAVQEVEQLREKVYASLEEY
CKTRYPDEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLTGDTPLDTFLMEMLENPSPQT
Download sequence
Identical sequences V4AHL7
XP_009056560.1.39240 jgi|Lotgi1|162352|fgenesh2_pg.C_sca_33000164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]