SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162544|fgenesh2_pg.C_sca_34000147 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162544|fgenesh2_pg.C_sca_34000147
Domain Number 1 Region: 101-158
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000445
Family Tachycitin 0.085
Further Details:      
 
Domain Number 2 Region: 362-425
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000628
Family Tachycitin 0.026
Further Details:      
 
Domain Number 3 Region: 202-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000165
Family Tachycitin 0.045
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|162544|fgenesh2_pg.C_sca_34000147
Domain Number - Region: 424-477
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000186
Family Tachycitin 0.035
Further Details:      
 
Domain Number - Region: 533-590
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0602
Family Tachycitin 0.068
Further Details:      
 
Domain Number - Region: 486-522
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0968
Family Tachycitin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162544|fgenesh2_pg.C_sca_34000147
Sequence length 602
Sequence
MHLGSIYLMVVLLIYFAYTDDRKERENVDVINPEENLVQDDEQYVGDSTENIEKSGSEEE
EEDKEAIEEEEDEEEELNYRYIPEPAQDIVDNGKKYIQVHCSFKQDESLIRHPSNCSRYF
VCSYGVVEEMPVCDDGEVFSIQVSECVKKGSENDDCDKLPFDSPPEITRGTQPSLIWHPR
HKSPRSQFRQPTTLQMKVPHIELESFTCSATGKVLSHHSENCAWYYNCSAHPDAVMQTFY
SGFIMECPYPQLFSTETKQCEDFEDVKCGDRYEPKSPCDYRANHCHETSHCIPCWVRYAS
CLELPDGLNPWSELEWKPFFVECYKERTVFQGVCDKSAVFSPLTRACETPYSIPRQHGGW
RPVCDGRRDGIYADEYGRCDIYYVCKGYIFTGFFRCEKGEMFNPVISICQKPEAVPYPCG
DLEMPNICESSLNGYHLDMFGRCTHYFECKDQQLEGISMCPSGIFNPELQICESSRDQPK
PCGNLTNLCTHKNDGFHSDENDCTKVFQCERGLTMTSYDCSGSVRTECDVCNTPTECNDK
PNGLYPNLKEGVGYYYDCVRSQIQNHYKCDKEKGGPIFNPVKQRCFYPEDLCKEVFSLKI
AW
Download sequence
Identical sequences V4AGU2
jgi|Lotgi1|162544|fgenesh2_pg.C_sca_34000147 XP_009056767.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]