SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162739|fgenesh2_pg.C_sca_35000140 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162739|fgenesh2_pg.C_sca_35000140
Domain Number 1 Region: 11-246
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.49e-71
Family BAR domain 0.000000606
Further Details:      
 
Domain Number 2 Region: 280-365
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-21
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162739|fgenesh2_pg.C_sca_35000140
Sequence length 369
Sequence
MSFAGLKKQFNKANQYMSEKIGGAKGTELDDEFMEMERKIDVMGNLVQDLIAKTQEYLQP
NPASRAKLSTMHTISKIRGQGKIAPYPQPEGILGEHMSKHGKDLGEDSVFGQSLMESGEI
FKHLAEVKYSLEDNVKQTFLDPLTQLLSKEIKEVNHHRKKLSGRRLDYDCKRRKKEKGGA
NVTEDDLSMAEEKFDETKTLTETAMNNLLDNEVEQIAQLQAFIEAQTNYHRQAMEALQSL
CETLEEKRNEAANKPRNEHIPKRISSFRRSPSPSPLYETPHDNNMGNSGSYNFGSSAPPN
YNQSVSNKQQAKCEALYDFEPENEGELGFREGDTITLLSHIDENWCEGSLNGVVGYFPTN
YVNILVPLQ
Download sequence
Identical sequences V4BTY8
jgi|Lotgi1|162739|fgenesh2_pg.C_sca_35000140 XP_009056988.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]