SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162880|fgenesh2_pg.C_sca_36000108 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162880|fgenesh2_pg.C_sca_36000108
Domain Number 1 Region: 28-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162880|fgenesh2_pg.C_sca_36000108
Sequence length 184
Sequence
MEAEDGKLKCNCPSGTFGEDCSLGVCEIENPCLNGGTCVPASNIADTPSCICPPGTFQPV
CEQCYYNFTRDAYIQLDSQVMLAINSLNQTQCDEECDKDERCTFNFIGLDGCYIFEKPVI
FASGNGDLNKYKERCMQMEECLLLTHILEDNKCFLFNVTLNNALSILRLIEGQHGNNIAE
KICC
Download sequence
Identical sequences V4AAU5
jgi|Lotgi1|162880|fgenesh2_pg.C_sca_36000108 XP_009057146.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]