SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162916|fgenesh2_pg.C_sca_36000144 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162916|fgenesh2_pg.C_sca_36000144
Domain Number 1 Region: 600-664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000032
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 482-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000025
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 660-716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 294-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000292
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 5 Region: 539-604
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000375
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 359-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 7 Region: 410-465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000236
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 8 Region: 211-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|162916|fgenesh2_pg.C_sca_36000144
Domain Number - Region: 256-298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000403
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number - Region: 152-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000683
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 180-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162916|fgenesh2_pg.C_sca_36000144
Sequence length 724
Sequence
METTYQKLTQTKPFITYYVSKQIQVTLKTQGIWIFYFYVYYLLRFETNTGILFTMRLHFL
VAVLVVLVLIDVGEGYYRRYYRYQGGRSYYRYQGADRDNQYEEERRYYRYQEADRDILRE
ITIIKCLKWSIVKYIVIQFSCPKPDPCAMIDCNYKGKCVDGKCQCNTGFHGQFCSEPIPD
CQNGGNLVVENGKLKCNCPLRTFGEDCSLGVCDIEGESPCLNGGTCVSAVNIADTPSCTC
PPGTIQPVCELKDCGAEYTCNEGHEVASGDFSIKCLVSGQWDVANILVCQAKDCGAVPPG
NFSTGTAASGTTFPNKADYTCNEGHEVAGGDFSIKCLASGQWDVANILVCQATNCGAVPP
GNFSTGTAASGTTYPNKADYTCNEGHEVASGDISIKCLATGQWDVANILVCQAKDCGAVP
PGNFSTGTAASGTTYPNKAEYTCDEGHEEASGDISIKCLASGQWDVANILVCNQVKDCEA
VPPGNFSTGTAASGTTYPNKADYTCNEGHEVASGDFSIKCLASGQWNVVNILVCRAKDCG
AVPPGNFSTGTAASGTTYPNEADYTCDEGHEVASGDFSIKCLESGQWDVANILVCQAKDC
GDLPPGTLSTGRVNGGSTFPNTANYTCDEGHERESGKTEISCLASGQWETDVLVCKPKYC
GSIPNGFYSYGNAPDNTFPNKAEFKCMGGFVRVSGKTEISCLASGKWETDVLVCKGNLLQ
PYYE
Download sequence
Identical sequences V4A6A9
XP_009057181.1.39240 jgi|Lotgi1|162916|fgenesh2_pg.C_sca_36000144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]