SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|166759|fgenesh2_pg.C_sca_61000007 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|166759|fgenesh2_pg.C_sca_61000007
Domain Number 1 Region: 13-116
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-21
Family Pleckstrin-homology domain (PH domain) 0.000031
Further Details:      
 
Domain Number 2 Region: 133-200
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000327
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|166759|fgenesh2_pg.C_sca_61000007
Sequence length 201
Sequence
MDWNSAMNTDESLTVVKEGFLSKRGEHIKNWRKRYFILRSDGSFLGFRAKPEGGDLSDPL
NDFTVKDCQLMKLERPKSNTFIIRGLQWTTVVERMFCVDTPEEREEWIQAIKSVSETLKV
DEDEACGPAERGKKKSLEDFEFLKVLGKGTFGKVILCKEKSTSQLYAIKILKKAVIIAKD
EVAHTLTENRVLQHTKHPFLT
Download sequence
Identical sequences V3Z7D1
jgi|Lotgi1|166759|fgenesh2_pg.C_sca_61000007 XP_009062453.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]