SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169157|fgenesh2_pg.C_sca_82000099 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|169157|fgenesh2_pg.C_sca_82000099
Domain Number 1 Region: 24-136
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000388
Further Details:      
 
Domain Number 2 Region: 188-288
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000000118
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00018
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|169157|fgenesh2_pg.C_sca_82000099
Domain Number - Region: 405-463
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0615
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169157|fgenesh2_pg.C_sca_82000099
Sequence length 477
Sequence
MTSNRVKPTNKDSLLLAADENETLFSCLGKGCVTLASGVVQLYLSDTQDGQRWNKRCCGV
ATLIKDNTKRSYYIRVYDIKKKQMLWEQELYNQFRYKSPRNYFHTFECEKQQAGLNFASE
DEANLFKSAVEQKLHERSQRKMGNQPKMSTSTDSKLNGSTNALNTAKSKSKKEKKKGKLT
KDDIGTPTNFKHLSHVGWDPNKGFDMNNLEPDMHNLFQSVGINSDVDEDTVEFIYDFLEK
HGGIDAVKKEIAQRPAPPPPPTSLGTKTGPPAPPMRSPGSAAPAPPPPARQINHAPPPPP
ARVTGGRPSSAQRGVARPPAAAPPPPPMSAPSSRPPPPPGVPAPPPPPVAPQAPAPPPPP
PTGFTPAAPAGANTDGRANLMDAIRMGKKLNATPADQGSNDGGDGHGMLLKQIQTGKSLK
PVEQTQSRAPSMNEQDGLVGALARALANRQKAVRGSDDSDSDDDDDSEEVDDDEWDD
Download sequence
Identical sequences V3ZHJ6
XP_009065704.1.39240 jgi|Lotgi1|169157|fgenesh2_pg.C_sca_82000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]