SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|169789|fgenesh2_pg.C_sca_89000036 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|169789|fgenesh2_pg.C_sca_89000036
Domain Number 1 Region: 555-720
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-20
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 2 Region: 301-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 517-561
Classification Level Classification E-value
Superfamily Kringle-like 0.000000457
Family Fibronectin type II module 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|169789|fgenesh2_pg.C_sca_89000036
Domain Number - Region: 456-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.033
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|169789|fgenesh2_pg.C_sca_89000036
Sequence length 1241
Sequence
MRISRNIYLYITLAAVLVGICESQVYDSCDGVARALGSGAGDGEYPIKIDERLAVPLYCA
DLDRNPQAYVPLKSGRVNNFGSVYMSVGSVKDCGTVVPPQNYSAWGRTEFLRLQIDPVHL
KIDLNNFKFTHTIGPRQICFGCAGDKFSATPKCPPRGKFKISLAGTPFSIDDSVAWKWTG
QFPDGSTSGQANILTTSYIGCFKDAVDRLLPVMIYNSKTLTIPICIEKCKAKGYRYAGAQ
YSTQCFCGNSHNKYSISKESECKMKCGGGGTDQVIEGICGGYPGNCYPTINGQKGFTLQL
VKTQPCFKNPCQNEAICVALTEDEFTCSCLPGYVGSLCENLQTIITASGSDCPTGLQPEQ
CSCDKCTGARFDGDVCVASNGKPKTTCRYDDPGHVILFNVQGTASDAYCPVGTEIVGCNY
WDSKNRKSGNGQGSLDTKSRHCSLKGCSTCKVTARCKKYDCGCENNGVCSKVTGTCSCLP
GYTGSRCQTFDYCSVYEDKYNKTACKAGECQAVPSSDIRAFGGDLAGDHCVFPFTYQDNS
YSRCVEDNGVGPPFACSTYFDGKNDYIDLGQWSPAPVYTIAAWVKPTKKDKTRRTIIGGV
NICRDFGLYLQNGHFNAFYYPASKAGCTAPLQGASYSVGQWYLVSVSNNGTHMRLDVSGS
DSILVPVQHYKILTTTGLRIGGSQCCAGDTFQGNIKSIKIWNRALLTEEVKMSMRYVNSI
NSTMEAMYGGLISHYELGHDVNLPCNGIDHGGDDWEVRNSQQLSGIHCNVSRFSVPKGII
ALIKPYDGTNGGTFEVYALDISIEGVLDGSGSGYRGGLVPANPADNGVQGESYSGQGKAS
TAGNRGGGGGGAGGKSNGRGYGRPGAGGGYGTKGQSPNKQKNSGSGWSMYGTTYGTPQLD
TLYLGSGGGSGGNAKDLTKSPKGGRGGNGGGIIGLYASRTVTVTGIINVSGETGQGDVVS
SSGCSTCPKACTDSKNCQGSSTKSCWDTSGPGGGGSGGSVYISGQIVDVGHDRLWAMGGS
GGAGGIGGCGGDGGVGRIHVDAQIFKGYVTQGKSGYLQTVTSQSSYKDLSIPGQKLIIPK
TTVYGNEIYRGCFQDDSNNRHFYHQVGQSTSSKITPQYCINLCRNNNYRYAAVEYGRECF
CDNAFDWKLKKSDNDCNMPCAGDKLQFCGGSLRMAIYGPHPMSLAIGYNGVQQQCQPWCV
TADTDTTNPKWGQCDLSSKKSSSYKIHCQCPAGMIGSNCDQ
Download sequence
Identical sequences V3YXZ0
XP_009066331.1.39240 jgi|Lotgi1|169789|fgenesh2_pg.C_sca_89000036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]