SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056
Domain Number 1 Region: 103-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000871
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056
Sequence length 144
Sequence
MKLFFGIVLMNLGLVAVDCGQRFWRMKECDHKRFQLGDTPELKSKTKYHCVKMCQDEAEC
LTIFFDGTHGRCYKFDKLPKSTCHNLVEYYSGKNHEFLYKGIQCKNGGTASEDKLNCQCV
NDWSGRFCEIPKDSNEEDEKEDAY
Download sequence
Identical sequences V3ZDU1
jgi|Lotgi1|170260|fgenesh2_pg.C_sca_95000056 XP_009067132.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]