SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170342|fgenesh2_pg.C_sca_97000025 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170342|fgenesh2_pg.C_sca_97000025
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-52
Family Nuclear receptor ligand-binding domain 0.0000116
Further Details:      
 
Domain Number 2 Region: 86-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-26
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170342|fgenesh2_pg.C_sca_97000025
Sequence length 469
Sequence
MHGHHLEAYLDISPPPSPAMGKVVSEGDMPPDVHQSQFSVFDHQITNNVSQDAYTFHSED
TKYSDVMATDVKRKKGIGVAGKSIEEELCRICGDRASGYHYNALSCEGCKGFFRRSITRG
ATYSCRYGGNCEMDMWMRRKCQACRLRRCKECGMKEECLLSDEQCKARDARRKAKAKVNP
VKTEPIPDSNGLSPESKQRSVGDRNGGTQSVYTNPLTVINSNPMNKVAHHHRQLIEEVCR
LQDKYEFPDEADVDKATCVKPDMKEVTADAMFRDMAEMTVLITNLIVEFAKSLPGFTSLS
KADQIVLLKAASSEVMAIRAARCYDLETRCIVFANGVPCTLENMKATGMGEYAELTYQFC
HNMAVMETDNAEYALLTAISIFSERPGLSEKDRVEEVQYRYVSALESYEHIKRHKGACSF
GRILSLLPDLRSISAEHSKTIVEISQQSSHMPGDYCEVKDIYVDPPEGT
Download sequence
Identical sequences V3ZDF9
jgi|Lotgi1|170342|fgenesh2_pg.C_sca_97000025 XP_009067232.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]