SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|170757|fgenesh2_pg.C_sca_103000063 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|170757|fgenesh2_pg.C_sca_103000063
Domain Number 1 Region: 196-465
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.22e-78
Family Mitochondrial carrier 0.0000208
Further Details:      
 
Domain Number 2 Region: 21-191
Classification Level Classification E-value
Superfamily EF-hand 3.46e-36
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|170757|fgenesh2_pg.C_sca_103000063
Sequence length 472
Sequence
MPGQEKHSRSKEEAIRSITEDTKLKELFKKIDKNKNGIVDFDDLTEALKAMDIHTTPAHA
KKIFDKCDEDHDGQIDFREFVKYVTEHEQTLKLFFKKIDTNSDGIIDANEIKASFQKLGV
NIDKKEAENLLKRMDKDGTLNIDWNEWRDYLLLSTDPDVDIRDILHYWRHSSIIDIGENG
MIPDDFTEKELKTGLWWRQLVAGGGAGAVSRTFTAPLDRLKVLLQVHGSKHNLGIVSGFK
QMLDEGGYRSLWRGNFMNVIKIAPESALKFMAYEQIKTLIKGDGKHEIGVLERLVSGSAA
GAISQTIIYPMELLKTRLALRRTGQYNGIFDCAKKILKAEGIGSFYRGYIPNLIGIIPYA
GIDLAIYETLKKFYMKKNKDKDPGVFVLLGCGTVSSTCGQLASYPLALIRTRLQAQSSTE
KDTLMTMSKKILKTDGPLGFYRGIAPNFLKVAPAVSISYVVYEQIRKQLGMN
Download sequence
Identical sequences V4BFA4
XP_009044843.1.39240 jgi|Lotgi1|170757|fgenesh2_pg.C_sca_103000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]