SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|171663|fgenesh2_pg.C_sca_118000029 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|171663|fgenesh2_pg.C_sca_118000029
Domain Number 1 Region: 99-135,172-399
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-65
Family Nuclear receptor ligand-binding domain 0.00000438
Further Details:      
 
Domain Number 2 Region: 24-47,77-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000201
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|171663|fgenesh2_pg.C_sca_118000029
Sequence length 404
Sequence
MKKKNLYGVPYIPSYMDLTNGPEPCVVCGDAATGYHYRCMTCEGCKVYKPVLQTHTKDYF
FLEPYLNFAISYYEKGFFRRTIQKELKYHCKWNQNCEIDKTTRNQCQECRFQKCVRVGMA
TDLVLNEKQRKAKRKLIEDNRERKRDEVVRQRTSPEPNDYEVLNDNDKKMIDDITNAYNN
SSIKSHPSRFMMPQFDSKYPNQSAEIAAWQQLAEAMTPSIVKVVEFAKGVPGFTQLNVDD
QILLLKSCCMEIMCLRAARRYEPDEQILVLSNGMTIHKSQLNHVSVGALVEPIFEFAIGL
AKLSLDETEVSLLAAVLLMQSDRTGLKDSESVEKLQDAILGAFKRYITCKRPHQPVHWAK
VLMKVTDLRTISTRHAERVLCARIDSPAGIPPLFMEMFKENTSS
Download sequence
Identical sequences V4B6N7
XP_009046109.1.39240 jgi|Lotgi1|171663|fgenesh2_pg.C_sca_118000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]