SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|171961|fgenesh2_pg.C_sca_123000029 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|171961|fgenesh2_pg.C_sca_123000029
Domain Number 1 Region: 42-219
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-27
Family Nuclear receptor ligand-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|171961|fgenesh2_pg.C_sca_123000029
Sequence length 242
Sequence
MSIYSSVNLPGVIKLQQNPCKIWKIHKTKSGKVPVEPKTPETVKEVWDLVINGIPIINKR
IIGFCNSVPGFSSLCSEDQQPMVKHAYYSIWMLTTSEFFINGESYLRFPNGRFYTKFWMK
NFLTEKRVAHIFAFAEKFNRLKLTDTEVGILSAIQLMTYDCDELILENAQSVQILNVHYL
DILVQLICESHPNTMCETLLEILSLFPHLCYINKMQRDMAAEFLLNKPPRPDKKAAEDSV
KS
Download sequence
Identical sequences V4B4Z1
XP_009046777.1.39240 jgi|Lotgi1|171961|fgenesh2_pg.C_sca_123000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]