SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174061|fgenesh2_pg.C_sca_180000025 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174061|fgenesh2_pg.C_sca_180000025
Domain Number 1 Region: 268-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family Cripto EGF-like domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174061|fgenesh2_pg.C_sca_180000025
Sequence length 366
Sequence
MYKVCLLVVFLAMSSAMGRHFPKKSLLDKRLLESENFKHLSRHVFRRLITNNSSIILVKN
MKNLKRPNGEITFNSENSVSVPILPKNTEMLKERSENPQKIKKILKQVASLNKKHGKRVY
RFVTIPTNFKRVSVEDVRIRKNNMVNRPNHSKSHRRVISKRNKKHIKKVNKLGKLNSGNT
RKHQVQIKRTKKAIKSKRRIRKHKKGKRVYRFIHSRKNDKLTRISDTTMARSTHTTMKTT
TSMFPETTTESFQEPGRKHNKRGSEITKSCGNIMHGVWFKNQCNICRCFNGLFHCLPSVS
QGCDQRQNAEYDRYFLYPIVSGMNPDFETPQFELPLSSAITIRSPITLALCVILSVLSAY
CNLYLW
Download sequence
Identical sequences V4ANF6
XP_009050634.1.39240 jgi|Lotgi1|174061|fgenesh2_pg.C_sca_180000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]