SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174238|fgenesh2_pg.C_sca_187000018 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174238|fgenesh2_pg.C_sca_187000018
Domain Number 1 Region: 134-289
Classification Level Classification E-value
Superfamily vWA-like 9.64e-47
Family Integrin A (or I) domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 289-408
Classification Level Classification E-value
Superfamily vWA-like 1.13e-33
Family Integrin A (or I) domain 0.0000859
Further Details:      
 
Domain Number 3 Region: 672-751
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.58e-17
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 405-495
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000314
Family Integrin domains 0.001
Further Details:      
 
Domain Number 5 Region: 36-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000785
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 584-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Integrin beta EGF-like domains 0.0033
Further Details:      
 
Domain Number 7 Region: 628-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|174238|fgenesh2_pg.C_sca_187000018
Domain Number - Region: 543-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family Integrin beta EGF-like domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174238|fgenesh2_pg.C_sca_187000018
Sequence length 824
Sequence
MNKKWCINIVILLLFIISVRAQGNRGSGNICLSDTAQKSCGACIATAAECAWCKSESFFK
DGRLRCDRYENLAKLGVCQPDDIVYPDDNLQLTKNDRVQDGVNPEDAVQIQPQQVRLKIR
PNKPIKFKLNFRQAENYPVDLYYVMDLSNSMEDDKDKLAELGNLIADSMSKITKNFRLGF
GSFVDKVVMPYVSTVPRKLRVPCFTRAGTPCESPYSFKNQLSLDLDTSKFAVQVMAANVS
GNLDAPEGGFDAIMQAVVCENQIGWRPISRRMLVFSTDAGFHYAGDGKSQIGWRPQSRRM
LVFSTDAGFHYAGDGKLGGIVTPNDGNCHMDFRGVYTESSNYDYPSVSQIASKVGEKKVN
IIFAVTKDQKPVYDKLSNMIEGSIAGELENDSSNIVDLIRENYETITSKVVMNTENAENI
TVKFYTRCFGTDMKETNECEGLKIGQNVTFEVEVTVTECPANKSKWQRAFDIYPVGLAEK
LRLNLDLVCECECERPGQEEPNSPLCFFGNGTYECGKCTCNPGRYGKECECDASKVSDEE
SDKKCIKPNSTTPCSGRGECVCGICDCYPRTANSAQKFSGTFCECDNYSCDYYDGLICGG
SERGTCDCGNCVCNPNFDGPACECDNRNISCIASDGTLCNGHGECVCGTCQCDKESQYRG
KTCEECPTCTRRCNENKECVQCVAFKSGPKTQDECDRDCRNINVQSEVSKSDGVQICQFK
DDDDCLFTFTYGFDSNDELQIKVQRTKVCPESVNVLAIVGGVVGGIVLVGLALLLIWKLL
TVIHDRREFAKFENERQNAKWDTGENPIYKQATSTFKNPTYGGN
Download sequence
Identical sequences V4AU86
jgi|Lotgi1|174238|fgenesh2_pg.C_sca_187000018 XP_009050816.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]