SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174250|fgenesh2_pg.C_sca_188000011 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174250|fgenesh2_pg.C_sca_188000011
Domain Number 1 Region: 169-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000295
Family EGF-type module 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|174250|fgenesh2_pg.C_sca_188000011
Domain Number - Region: 82-217
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0518
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 256-304
Classification Level Classification E-value
Superfamily Prefoldin 0.0654
Family Prefoldin 0.021
Further Details:      
 
Domain Number - Region: 42-65
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0745
Family AN1-like Zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174250|fgenesh2_pg.C_sca_188000011
Sequence length 376
Sequence
MAICHLQNIPIIKKISAKFLSRHMYMGFLPPGQNILFLFNRRRTKCSNPFCQKHRRHVCM
QQTQQAQPVPVRQSYWRSVHRQSPERCADGYGRCPRFRVVYQRAYRTVFRMRISLRLVPK
CCPGWKRISPHDAGCLKPVCENGCVGGICVGPNKCECKAGWMGPNCTKDVDECAGSHGCS
QECLNQQGSYECACSDGFTLDSDMKSCKFCMSCTKEYREMQDSIGVLTRKVRSIEDVELH
GADKRPVTTDTSDHQVMNDMAQSIGELQKKVNHLEKEKDMLMGNLTKMENNFKHAMDVMD
EIKATTKPVTVTPSTTTTLDPYNPNLYAANPDVMPFDRIASLSEQISLLEERLEGCTCKE
YEDYNPRGRRGDIPRG
Download sequence
Identical sequences V4AMV7
XP_009050828.1.39240 jgi|Lotgi1|174250|fgenesh2_pg.C_sca_188000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]