SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174251|fgenesh2_pg.C_sca_188000012 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174251|fgenesh2_pg.C_sca_188000012
Domain Number 1 Region: 149-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000315
Family EGF-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|174251|fgenesh2_pg.C_sca_188000012
Domain Number - Region: 195-301
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174251|fgenesh2_pg.C_sca_188000012
Sequence length 343
Sequence
MGIGNEQHVAVAVFRTTRRLFCQSQHLTRITDRRHICQRDQIVMRPVRRPQTFCRPHYQR
MIMPCPNNSNQLCNTFRFRCRIAQRSVLHMVPQREQSYSCCPGWAGYSPRYRGCMNPVCE
RKCENGGHCSKPGQCSCPNGWSGDCCQNDTNECKGEHECQQVCNNRPGGYNCSCFDGFTL
QSDQKSCQFCLTCSNEYRNLEVENRRLKTEIDSMESQMSLLNRTVSSVTEKLTRLSQTVY
LEDRTKIANNAHNTDVQDALVTLSERVGELEESNGNCFCSSEIARAQNDVYKEFKRMEKD
LDTRISLLEFEQIEPPPSFRPPWIDPTVFTPSENVESKKPASP
Download sequence
Identical sequences V4A3N0
XP_009050829.1.39240 jgi|Lotgi1|174251|fgenesh2_pg.C_sca_188000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]