SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174648|fgenesh2_pg.C_sca_207000014 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174648|fgenesh2_pg.C_sca_207000014
Domain Number 1 Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 36-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174648|fgenesh2_pg.C_sca_207000014
Sequence length 118
Sequence
MVNTVVVALFVLVAVITVSDAQIANCLTTVGCGGANRGFCDPTGAVTPGTGTCRCYRGFY
LNPTNPTLCQDINECIVYPCGRNSGRVCINTIGSFYCQYNSNSFQNLLNYYYISELLD
Download sequence
Identical sequences V4C629
jgi|Lotgi1|174648|fgenesh2_pg.C_sca_207000014 XP_009052238.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]