SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174753|fgenesh2_pg.C_sca_216000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174753|fgenesh2_pg.C_sca_216000002
Domain Number 1 Region: 1162-1276
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 6.28e-20
Family Galactose oxidase, central domain 0.02
Further Details:      
 
Domain Number 2 Region: 25-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000288
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 683-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 759-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000347
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|174753|fgenesh2_pg.C_sca_216000002
Domain Number - Region: 839-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number - Region: 1004-1080
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000222
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174753|fgenesh2_pg.C_sca_216000002
Sequence length 1301
Sequence
MKYITLKLPLTVVAAIVLVCRLTEGCTGRKVLNGEKGIISDGPNEYPRFARCEWLIEAGG
PNKTIHLEFKSMATECSFDFLFVYDGISYSSRMIASLSGDSQPETLTATSGYTVVSEDLD
HCLDYSTNLRCLNDPDCVYCSNIQNKPKSDNNNNNNKDQEDNPGCIHRTRTDMCLNGDIQ
DLQSKRCPGICSVLSSCSACISQGRGANLTSSLPRRRVYNEACSWCVKQAVCTPRAVPQG
TCLAADNTVSGIQGWWGGLSANLTSHQQCQTADFPAGLQWIEYRYPMNNTYPDHLSIVRK
TEQTLQFKYRFMREIEDEFTYYGALRGFIHPLNAPPPSGESYLQLHLKMIHGQSLLYLSK
SDNPDNMEMVLSLASYATYNESVARRLDRTPMFPNIARGNRYFIEIILKHIVKKERGKDI
DKYPESNIKLEWNGALTSLTQQPLTSEFLQPYTSETCSGHYNCLACLSNNACGWCNALRT
CMNRSDAMGTSVCANLSSIQFLITTPSQCPMCDHYVECGSCTKDNLCEWMLKDGHCTRRY
RYDEAVRAPENCRVPCQYRISCDDCVSQSDECAWCENTRTCLPFSEYVPRYLYGQCTKWI
DMVQISQDVCRQCNLSTTCSQCLEMYGCGWCYNIDNPTIGYCIDGDFNGLVDNSTCSAVL
TDIYNVSDSVTPNTSWAYHNCPDIDECRLDLHDCHDNATCINTEEKYVCECKPGFKGDGT
KVCDKSCLYECIHGNCSGEPDHICNCIIGWSGPDCSVDCGCNNHSTCHTGVGVCDECHHG
TTGLHCELCQVGSYGNPLEPKVYTGYMICDQYIQVIYLPVYTGYMICDQYVQCLYVVCCN
GHGDIKYGICNNVTAECYCTHNTKGLHCQQCNEGYYGDPRHGMKCYLRCDDRTILTNITQ
GALGTHQGSGVVHRSHAYCLWLMTVFSDISNINPPPDIPVPSIRLAVEGDMEVKCGRHLL
YIYDGTPEFIILILLFQHLLYIYNAPTVYLPWYSRVYHFNIIITYCIFTMHLLYIYDGTP
EFISGVNNSATLLGAFCGMKPGRDFVVVAKSGVITVYFEADIRRSSSRGFNASFQINMCP
DECQGHRECVEGECVCQRGFGGINCEVELCPRNCSYNLTQGECNHEYGMCECTDNFVGAA
CNIPVDTNLPRLELLIDPNRMKNQTNLPPALMGHSLTSCGDGNLYLFGGISPSQGLQNDM
WVYEISVRKWTKVIPIDAKPSGRYYHGAACVPLLKIIFVFGGFLTSSSGESYVPTNQLWK
YNIESQVWSNITVRFYINLEPETCFGLIVSCFMTFRQLSEL
Download sequence
Identical sequences V4APD2
XP_009052650.1.39240 jgi|Lotgi1|174753|fgenesh2_pg.C_sca_216000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]