SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|175169|fgenesh2_pg.C_sca_250000001 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|175169|fgenesh2_pg.C_sca_250000001
Domain Number 1 Region: 29-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|175169|fgenesh2_pg.C_sca_250000001
Sequence length 239
Sequence
MNGTLREEKVENGKTILEMVKEVACPGECSDQGLCEDGKCICKSGFIGSDCSVSLNEPPL
AHNLEADGHCDLSVDDCTEVAVFGGRFVDAEQTKCQLLPFKITNDQVTVSEGRIIKTAVF
ESIGEVTCKLPSRKRRRRSVDVPVIDETVTGYKVSVSNNGIISPLRRLTLYCGRIMPSPP
FVHMPSLLDTICYSNGLSQSNYCIIDTICYSNGLSQSNYCIIDAIYVIVMVFVSLPIVL
Download sequence
Identical sequences V4ANP3
jgi|Lotgi1|175169|fgenesh2_pg.C_sca_250000001 XP_009054036.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]