SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|184265|estExt_Genewise1.C_sca_80561 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|184265|estExt_Genewise1.C_sca_80561
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-47
Family Nuclear receptor ligand-binding domain 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|184265|estExt_Genewise1.C_sca_80561
Sequence length 189
Sequence
MHKTIQDVVIFAKKIPGFTGLDQDDQISLIKGGCFEVTCVVCAPFVDNDSNTIYLLGNGT
LITREEMKIGFPLGEHFVELLFNLCNRFNAFHLLDSEKALFSALVMISPDRPGLKNRDKV
CKLQEMLIQALQFEISDCHPDEVGLFPRLLMSISSLRELGVEHRRMLESLKGQMSFPHDL
YAETFDLVP
Download sequence
Identical sequences V3Z102
XP_009065329.1.39240 jgi|Lotgi1|184265|estExt_Genewise1.C_sca_80561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]