SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|189647|estExt_Genewise1.C_sca_290426 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|189647|estExt_Genewise1.C_sca_290426
Domain Number 1 Region: 302-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|189647|estExt_Genewise1.C_sca_290426
Sequence length 626
Sequence
MTSKVCVSVCLVLGCVFAIYGKVSPIDLDLNLDGKESKDIGFDGLTSLASFSTVSDPKLD
ENSTNAKNAVLPGDIREFSLTQWTAKQEIQPKNGTSFTRVKRASKKGKKKRGKGRKRKGR
KGMKKKKGKKRKGKKKGQKGKTIKKGKKKGKRKKKKGRKGKKGKNVKKLKGKRKGKKRNG
KKKGKKGNGKKKGKKGNGKKKGKKGNCMKNCKKVYDKKKDKGKKIIKSKKEPEGKKESDD
NLKELLEKIKEEKDDAVNSPELKKIYPVKVKIETTMPVNKEKMKEIKELSSIKKKTDKTL
TKIDPCELKPCRHNGICEKLGSTIKDYKCVCPAGRKGKHCEFSAEKIKLKSDQGKPKKHK
KHKAKQEDDANLALIISLSTVIPVTVVIALILTIHCVRVKNKRAQLLAKFRRDKRFGKVP
EPVPGVMALSNQMFCGCCSKQKKKAPAYTIKDIEVELEKQATIEKLNELIDKASGTKASK
LGGGKAKKGIKGGKSDASMMSEGSEGSETAGSSWGSDVSGVYGSEVSGISGSAVSAVSAV
SAVAAPVSEAKASDEQIEQLADKVAEAKLSVEQVDQLTELVQKVSKAKMEQEAQLTELDQ
QVSTAPMEEEQHPPAPPSPPPLPPLP
Download sequence
Identical sequences V4BYX3
XP_009055164.1.39240 jgi|Lotgi1|189647|estExt_Genewise1.C_sca_290426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]