SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|196436|estExt_Genewise1.C_sca_750129 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|196436|estExt_Genewise1.C_sca_750129
Domain Number 1 Region: 26-109
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000183
Family Prefoldin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|196436|estExt_Genewise1.C_sca_750129
Sequence length 132
Sequence
MASVKKETDRLIDHLSVIEEAAEDILSDKQQIIEFDLRRNKTREALRSLQKSNKEKKSWI
CIGGMFIKMPKKTAVKMLEKDYDELEKEINETRTKLKPKVNKLRDLQNEDDIKGFGLEPL
SQSEVRAVERLL
Download sequence
Identical sequences V3ZKH2
XP_009064583.1.39240 jgi|Lotgi1|196436|estExt_Genewise1.C_sca_750129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]