SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|196574|estExt_Genewise1.C_sca_770015 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|196574|estExt_Genewise1.C_sca_770015
Domain Number 1 Region: 124-372
Classification Level Classification E-value
Superfamily vWA-like 4.45e-63
Family Integrin A (or I) domain 0.00000221
Further Details:      
 
Domain Number 2 Region: 622-699
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000157
Family Integrin beta tail domain 0.0061
Further Details:      
 
Domain Number 3 Region: 27-75
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000523
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 393-458
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000235
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 5 Region: 537-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Integrin beta EGF-like domains 0.0071
Further Details:      
 
Domain Number 6 Region: 581-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|196574|estExt_Genewise1.C_sca_770015
Domain Number - Region: 513-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|196574|estExt_Genewise1.C_sca_770015
Sequence length 776
Sequence
MWSFGIVVCFGLNLIQSNGVNGQICQGETCSECISFSKDCRWCMQPNFHDTASLRCNKLE
NLLDAGCSEENIISPNSSIEYIKNEVVTDGDSSGQNAVQLSPQLVHIKSTPNTPVKIPIT
FRAARNFPVDLYFLFDASYTMKDHKNKLATLSQEMASKIQSISRNYRFGFGCFQDKVILP
FTDTKTSYFTSICRFKIGAPCSVCVPPFGYLHRLSLTNNIGDFYVTIQDSPLSGNIDTPE
GGLDAIMQAVACENEIGWREQARRLIIYASDNTFHFAGDGRLAGIVLPNDGKCHLVNGTN
TEDIRQDYPSIGQISQKVSEKNVNLIFAIVKSVEEDYQQLSKNILDSYVGVLEGDSSNVV
DIVRTTYEAIISEVKFKIDAPNNTVVKIFSNCNSEKMKETTECKGLSIGKEIKLEVQVYS
TKCPEKPDDRNRTINITAIGLSDQFTIQLESDCDCVCGFSEPSSPRCSTYGTFECGICNC
DVGREGDRCQCSEIDVIEGRNVDPCVSNKTTVKCMGRGECKCGLCSCELGYTGRYCECDT
NACEKLDGQICGGAERGRCVCETCVCNEEYTGSKCDCPTSTDACLAQDGTICNGKGTCKC
GKCICDALYIGSTCQNCPTCPGACEDNRDCVECIVFNEGELTQDECIEQCPVVEIVESIE
DLNETCQAKDIDGCKMIYKIVYLDDGNTTILAQKYKVCSTQIDMVPIIAGVLGGIVGLGI
FLLALWKILTSVYDNREYAKFQQEVDQVRWAQESNPIYKGATSTYKNPMCNDFDAM
Download sequence
Identical sequences V3Z1U4
jgi|Lotgi1|196574|estExt_Genewise1.C_sca_770015 XP_009064721.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]