SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|196914|estExt_Genewise1.C_sca_800226 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|196914|estExt_Genewise1.C_sca_800226
Domain Number 1 Region: 267-482
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-59
Family Nuclear receptor ligand-binding domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 24-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|196914|estExt_Genewise1.C_sca_800226
Sequence length 484
Sequence
MKMESSTSGNETCYPPDVKAGFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVY
SCVDNRSCHIDKSQRKRCPYCRFQKCLSVGMKLEAVRSDRMRGGRNKFGPMYKRDRAIKQ
QAVRQQQHILSQCSLHLPNGIPSLPPSPEDSHHSPQESTRHVTSSPVHSYSLSSSSTIPA
ITSHTSNANHTEGGGSFTVTGPLSAYPHPMRSHDPYIISHAFPSTIEALRAYPPTALSSH
QPFTPVVPPLVADLKSGLSEESEVKNKLLNFMQSEFGQFNINNPDKFLHILCKLVDQLLF
LMVEWARSSIFFKDMRVEDQMKLLQNSWSEILFLDFVYRQVHDCWGSEIVLENGQKINLD
ILDKLGLGDLKTRLLELIKKTKEVNLDIHEYACLKFIILLNPDVSGLENRQYVEESQERV
NASLLEYCLSFYPDVKDKFGQILLRLPEIRLISIRAEEYMYYKHMMGDVPDQTLLMEMLH
SKKK
Download sequence
Identical sequences V3Z0C1
XP_009065471.1.39240 jgi|Lotgi1|196914|estExt_Genewise1.C_sca_800226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]