SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|199557|estExt_Genewise1.C_sca_1210020 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|199557|estExt_Genewise1.C_sca_1210020
Domain Number 1 Region: 387-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000967
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000002
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 202-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 84-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000202
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 321-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000454
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000309
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 261-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000399
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|199557|estExt_Genewise1.C_sca_1210020
Domain Number - Region: 434-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000341
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 141-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00209
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|199557|estExt_Genewise1.C_sca_1210020
Sequence length 631
Sequence
MCLIRPADNEEEQNCMAYTINHNVFYSTTRDILPTEELRIMQEDEEISEEEEGEELEESE
EEIDLDESEDFKTTRKRQCKGKLESRFPCALCKQMFSNEMSLYRHMAMHTDLYKCEKCGK
CYSRKDSWQGHMLRCNPDKINDHKIYVCHNCKKTFATELGAQNHMVSCAKHYCSDCRTAF
ESEELLKDHECDRIVSNKKAVQFQCPVCKKTFSSFTYLKRHEATHQGAFQCKICNKSFSR
REEHGIHYRYCLGQTTIKKEGQINCDLCDVPFHDAKEYRNHIHEHTHPHKCEICRRRFIK
IGSLHNHKCEAVKSELENDVPEPCKECGKVFHTRQAMLKHEIFHREPEFSCHDCGKKFYR
KDYARDHICTLPDGTKEDVVCHECGKAFNSVSNLNKHVKTHGEKRYACDVCGKRFHYEAY
VRTHREMVHEKKYTFQCNDCGKVLTSKQGLISHNRQFHTENPPSYHCPTCKRGFKQRGNL
RTHMLMHGNEKNYGCNICGQYFKYPEQRNRHKLEHTMTEKFRCHICQKTFVRRYDLKRHL
SEMHSGHIYICTLCNERCSHRPTLIRHYKRKHPGNMEMVRDLDSINSMKRSVSDMPVEVK
QVKQESKDSTLLYEAMQQLEQAGLVESGQET
Download sequence
Identical sequences V4AF24
jgi|Lotgi1|199557|estExt_Genewise1.C_sca_1210020 XP_009046660.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]