SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|201560|estExt_Genewise1.C_sca_1820023 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|201560|estExt_Genewise1.C_sca_1820023
Domain Number 1 Region: 438-571
Classification Level Classification E-value
Superfamily TIMP-like 1.88e-33
Family Tissue inhibitor of metalloproteinases, TIMP 0.069
Further Details:      
 
Domain Number 2 Region: 255-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000809
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 3 Region: 311-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 374-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|201560|estExt_Genewise1.C_sca_1820023
Domain Number - Region: 70-149
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000156
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|201560|estExt_Genewise1.C_sca_1820023
Sequence length 573
Sequence
MFSAQQHPPDPCYEDSNPKRCIPDFVNAAFGMEVVASSTCGSPPSRYCKSTTDKEGKIIR
NCFICDANHPKRKHPSKYLTDLNNPNNLTCWMSEPFVQYPNNVTLTLSLGKKYELTYISL
QFCSARPDSMTIYKSVDYGKTWIPFQYYSSNCKEMYNKAPSAIVTKANEQEALCTEAYSN
IDPLSGARVAFSTLEGRPSAYAFDHSPVLQDWVTATDIKVVFNKLNTYGDEEKDEEGARE
SYYYSLSDFAVGGRCKCNGHASQCIPLKNGRLGCDCKHNTAGDDCERCKPFHYDRPWSRA
SAREANECVACNCNLHARQCRFNMELYTLSGYKSGGVCLKCRHNTAGRNCNYCKEGYYRD
RSKPITHRKACKACDCHPVGALGKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSKSPIAP
CIKIPVTDMRGPNRQPTQEDSCKKCKKRSRRLSIKKFCRRDFAIHAQVVSREKVDDWVKF
TINVLNSYKRGTSPIDRARRGGTYLWVPKKDLQCKCPKIRLSRRYLIVGKHKRNDSRSGF
VIDRKSVVIRWKDKWQRRLRRFVKHERRGKCHN
Download sequence
Identical sequences V4AN98
jgi|Lotgi1|201560|estExt_Genewise1.C_sca_1820023 XP_009050689.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]