SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|209261|estExt_Genewise1Plus.C_sca_30137 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|209261|estExt_Genewise1Plus.C_sca_30137
Domain Number 1 Region: 987-1283
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.1e-73
Family Complement components 0.0000222
Further Details:      
 
Domain Number 2 Region: 1363-1470
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.23e-24
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 818-868
Classification Level Classification E-value
Superfamily E set domains 0.00000127
Family SVA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|209261|estExt_Genewise1Plus.C_sca_30137
Sequence length 1513
Sequence
MVLLPKSFRPCTPYTFSARALGKASYTLTAQIEHGSSNDPTVVVASKPVNIRTTRKITMT
PPCDLTWKSYYIKVTGTGGANFTDRQYLNFNTKNLEIIIQTDKKLYKPGQTVKYRVFGVK
PDLQAVQDTFEVTVTDPKNNKIQLFTSNGDSYGVVENELKLSSEPIFGTWQIKASTKGSE
HVQTFKIEKYVLPKAEAKVIMPSVVGEKDTSIYVKVSSQYTFGKPVSGLAEIRIKVNWYA
TRKWQKDPATGKYGYIDVTQPDLMYEIQLDKNGEASVSIPMTELKTIAYRNSISYKTIVG
QVNVTDKETGAKYISQPSQVSISRTREKISFALNPQNYKPGFVNKLFIELRQQDGKPVQN
PKTVTVTSRVKVEIIKPKVLKEPTTTPKAKVPVAVPGEPVPIEPVMERMIALPYPKIDCE
SPEYEYKDLPNKTLSVPANGLVPYDLLVTEENSREVTLKAVYDGDTDVTISQTLTAFRSP
SNTFLSLTLTTPKPASGQKAEFVIKATREFDLVYYTVLSRGSIVLSSFEQFNSVARVQKL
VLPIESLMAPKLRIIAYIRVENDEIVADAISFNVEGVFKNKVSLKFDAKKVKTGSVSTLA
VEAFRGSNVYAVAVDKSTTLLGEVSDDHSQDVQDFLHQLDNGFTPYYGGPWLRGGGMIAF
RKKREALLRKRREAEKRSKRSSIWWPYPFFTSGTDVEDMFRNTGLHVVSDALIYQHKEPR
SCYRMYNRFMPMMAMADVGMGGPPVMENAAMGGAGEDVETRSFFPETWIWDSQNAGSAGI
ANFTLKVPDTITTWVASAFAISKNPSIGVGMTSDVAELTVFKEFFVSLNLPYSVIRGEEI
RLQATVFNYLGSAANAEVRLENPKGYVVVKVDNGGFEYESTQTQTETVQVPNDGTASVFF
TIRFLEVGNIDLQVYAGTSGAGDRVVRPMLVEAEGIPQEYNEVVLVDLDENQRKFNQSIQ
IRYPSDVVPDSQRIIITAFGDPLGSALNNIEDLIRLPSGCGEQNMINFVPNIYIRKYLDA
TGQLSSSLAAKIKSYLQTGYTTELRYKRSDYSFSAFGDRDDSGSQWLTAYVLRTFIEASA
HIYVDDRILSKTAAYLISNQNPDGTFREPGRVIHKELKGSSFEGDGLNAFTLIALLEVKD
KKVTAEAIKSSVTQLEAASATMTNIYDLAITAYALHKAGSKYAAQLLAKLESKQTSQDGM
VYWDVVVESDRAQYYWNPPHRKSSPVNIEATAYVLLTYAEMKEKLKGLPILRWLISQQNG
KGGYSTSQDTVVALQALSEYATNLSSGNWDVTLDIFVCRERKRWKVSKSSATIQRKWVTK
ETTSSVDIVARGQGRAVVMSTVKYNIAEVIVKSTWGLRVATESETKDVLIIQACFEWTVK
GESSGMSLLEVGLLSGYTVDEVPLNENKLIKRMETAKKKFTLYIDEVGNKPICIKLRLVK
AEIIGKLKPGFISIIDYYNPENSATASYKSTLGEGAPVCALCPQGACGDCVGWKEAINEY
INTLKVLVYFKLN
Download sequence
Identical sequences V3ZQP2
XP_009055359.1.39240 jgi|Lotgi1|209261|estExt_Genewise1Plus.C_sca_30137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]