SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|209765|estExt_Genewise1Plus.C_sca_40573 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|209765|estExt_Genewise1Plus.C_sca_40573
Domain Number 1 Region: 763-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 2 Region: 857-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 965-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0017
Further Details:      
 
Domain Number 4 Region: 507-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 5 Region: 333-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 6 Region: 1017-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 7 Region: 811-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 270-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 9 Region: 456-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 10 Region: 1116-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 917-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 12 Region: 1068-1116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|209765|estExt_Genewise1Plus.C_sca_40573
Domain Number - Region: 1519-1751
Classification Level Classification E-value
Superfamily Tropomyosin 0.000137
Family Tropomyosin 0.0059
Further Details:      
 
Domain Number - Region: 420-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1212-1364
Classification Level Classification E-value
Superfamily Tropomyosin 0.0268
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 108-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0283
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|209765|estExt_Genewise1Plus.C_sca_40573
Sequence length 1760
Sequence
MFYFLIKYEKPFLLTGLEGQRRRNRQRSRCEQGSCYPATGDLLIGREDYLSASSTCGAER
PERFCVVSYLEKDTKCFQCDSRQPWREGFNERSHKISNIVSSFKDRRNRWWQARNGEQDV
TVQLDLEAEFHFTHLIMTFKTFRPKALLIERSYDFGKTWKVYRYFAQDCARSFPGVPRGP
VRSLTDVICVQRYSAETPSTEGEVIFRVLPPFIRVDDPYSEKVQDLLKLTNLRVNLTELH
TLGDTLLDSRPEIKEKYYYSMYDMTVRGSCSCYGHAARCLPVPGYDTRPDMVHGQCECQH
NTKGLNCEMCQDFYNDLPWRPARQNQPNSCKRCNCNNHATQCHFDSAVYEATGRISGGVC
DQCQHNTQGRNCQECATFYYQDPNRDIRDPEICQPCDCDPSGSELNGECDARTDELAGLE
AGKCYCKKYATGSRCDKCIDNYWNLLQENPEGCEACTCNAIGTIGDFGCDQVTGLCRCKR
YVTGRNCDACYPGFFGLSAKDYGCDPCDCDIGGSLSETCDQASGQCQCRPNIVGRQCDQP
FPGYYYAGLDYYLYEGEHGQASGNGRVYLREPIPDAKYWTGTGYMLLTEGDSMEIMFSNI
DFPMYYDLVLRYDPRMPEAWSDVRITVIRDEPIDPNGLCARYNPADDVKTVRLQPSNRFI
SVSPPTCFEPGKKYTIRIDLNRYKEGESTPQATVLIDSILLVPNTDSIPIFQGPGLPLYL
KNQFTRYRCDQVQLGSLQSNIPDECKKHYFILCHYLTIIISACDCDLTGSLSRDCEPLGG
QCQCKPNVVGRRCDQCAPGTYGFGPSGCQPCNCNDIGALDNFCNGTSGQCSCADNVGGQT
CDVCIPGNWGFPQCRACQCNGHAETCDNLSGRCINCQDNTQGDYCERCLDFYYGEPRGAR
IPCQPCMCPGGPNSTLNHADQCSLDPRSRSFICDCKLGYQRPNCEICEENYYGNPLQEGG
SCQRCICNNNIDFAMPGSCDRSTGECLKCLYNTEGYNCELCTAGYFGEASEQNCKQCVCS
SLGTDMSLGECDRNNGQCPCLPNVIGQECDRCAVGYYNLSSGVGCSACNCDPTGSNSLEC
NQIDGQCDCKDDRGGRTCSDCADLLYGDPRDQCYDCACDRRGSRSLQCDRRTGQCECVRG
VTGLKCDRCARGTTGELPYCVPCGECFDNWDRIIRVLRDQTASLVETASNIQSTGAIKAF
DTEFKQMQSNINEIQSIISSSNLTQVDVRDIETMLDYIRRNLTENSKSINNVDEELSNTT
ARVQIGNTRIGVLKQQVADLKDLAERLRANATDIQARDVEGALNITREAERRSQDAQRLV
DSTSPLLTDSERTRRRVEDLISQNGAQFDDKLKRNKAELDKLDNKVTDLGGRIANINNMV
CGKPGDPCDVFCGGGGCNKCGGSNCGDGAVTKAESALDLANQAAEVLKIKEAEAEDLLSD
VREAKRGAEEAKDDAQMAYDVAVSAKNQSESVRTNLEDLLNRISDFLQPQRASPNDVKKI
AAEIMDMSISLTPKQIEDLASKINQTIQGLQNIDSILVDTRDDLNQARRLKQRADNASLD
ANAILKTAQEVLSALNGAKNAQEEASKAITQAQTDIKDAEADLTMIESETASAADKSNVS
LAIIGKLKERLNELRLKFTQNDLNVKRAEEAAQMAVDLANKAERDANDLTNKYQDASNQL
NQDYDSTTESQKRAKRLMERADLLAKNTQEKHNKLKKIQGEFDENQKNLVELSNLIDELN
RRMEIYLMEIQDKAKYYRDC
Download sequence
Identical sequences V4A8Q9
XP_009058110.1.39240 jgi|Lotgi1|209765|estExt_Genewise1Plus.C_sca_40573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]