SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|220259|estExt_Genewise1Plus.C_sca_600270 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|220259|estExt_Genewise1Plus.C_sca_600270
Domain Number 1 Region: 428-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000733
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|220259|estExt_Genewise1Plus.C_sca_600270
Domain Number - Region: 467-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 360-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000604
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 107-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 220-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 505-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 32-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 330-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 395-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0101
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 550-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 69-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0313
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 177-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0436
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 
Domain Number - Region: 252-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0637
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|220259|estExt_Genewise1Plus.C_sca_600270
Sequence length 593
Sequence
MNGGSARRAGSSCYCSCQAGWTGSTCETREVICQPCLNGGFLSSPSRCLCTCRDGYSGPQ
CETGKCGCSNVCQNGGIASTPASGCRCSCTNGYTGSSCTIPLCTPLTYPCQNGGTTTSNG
QSCSCSCPLGYSGLTCATNMCSGQCGNNGRGQPAVGGGCTCVCNTGYTGDKCTVSLCDDY
CGDNGFATASYASGCSCRCVAGFTGSQCQSRVCSQSLVRCENGGTPTSNGAACSCQCPPG
YTGSRCQTEICLGYCGANGTPGFNSVTGCTCRCNAGYTGPKCETNQCLDFCGIYGRPSLP
FNAGCGCICQTDYTGPRCDEQACTQARMGCVNGRAQISGRACTCVCNAGFSGPRCDRALC
DNYCSNGGSPFPTTSGCSCSCPAGFTGDRCQDALCSTYCVNGSPTSSNYPNCECRCNANY
IGPKCDTLDPCLSLTCNNGGTKVPQRGSCVCQCRPGYTGPDCRTSICSRSNCNNRGDSIY
DPLSGSCVCFCNQGYTGTQCELQTSCRDDCMNGGVARMAAPGVCVCDCQAGYTGTICETL
IETQTCTGSENKCQNGQPAIKNACTGQCQCVCNQFYAGAYCEIKIDTNVCDEC
Download sequence
Identical sequences V3Z830
XP_009062397.1.39240 jgi|Lotgi1|220259|estExt_Genewise1Plus.C_sca_600270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]