SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|227981|estExt_fgenesh2_pg.C_sca_10334 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|227981|estExt_fgenesh2_pg.C_sca_10334
Domain Number 1 Region: 3065-3245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.61e-33
Family Laminin G-like module 0.00044
Further Details:      
 
Domain Number 2 Region: 2896-3060
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-27
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 3 Region: 2615-2792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-26
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 4 Region: 2421-2603
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.96e-26
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 2240-2424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.12e-16
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 6 Region: 643-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000145
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 7 Region: 755-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000204
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 8 Region: 1047-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 1396-1440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 901-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 11 Region: 1454-1505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 12 Region: 702-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 13 Region: 853-894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 160-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 15 Region: 952-999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 16 Region: 359-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 17 Region: 1503-1544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 18 Region: 219-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family Laminin-type module 0.032
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|227981|estExt_fgenesh2_pg.C_sca_10334
Domain Number - Region: 1000-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00019
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 289-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 601-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.094
Further Details:      
 
Domain Number - Region: 807-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 1093-1148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|227981|estExt_fgenesh2_pg.C_sca_10334
Sequence length 3247
Sequence
MTFKVYQVAYVIVKAANAPRPGNWILQRSVDGITYKPWQYFALSDSECREFYGIQPTSGV
PKFSRDDEVICTSRYSRLNPLENGEIFVSLINGRPGVKEPTKTLLEFTSARYIRLNLQKI
RTLHADLMNFRNNENLTHLDPTVTRRYFYSIKDISVGGQCICYGHARLCRAQGADNNLQC
ECEHNTCGKNCEVCCPGFNQKPWGRGVNGNGNGYKCEACNCHGKASECVYNATVDSLGLS
LNERGQYDGGGVCINCQSNTGGVNCETCIEGYFRPMGVPATAPKPCRRCSCRETRTSTSR
CVTDDSRISEGLKPGDCICKPGFGGVRCEQCQFGFYGYPNCKPCPCNPAGSANPAICDRR
CVCKENVEGRQCDRCRPGYYNLDRNNPEGCTKCFCFGVTTSCGSSDWGISQVTEMNGWVL
STRMADGLTLLPRSFNGWLEAKTYILTGSDVEGTGSWPVTQTDIHYWVAPMVFTGNRLSS
YGGMLKFTIKYILDSNIDKRYHLSEPDVIIEGGGMMITNGQKYLREEIENRVGIVLHESE
WRKLITVDNRLTEVPLTKGDMMRVLQSIMRVMIRATYHTAQDTVYLRDVSLDVVSPSSRS
PMTLKSVEKCNCPPGYAGLSCESCSPGWRRQNGTLYNGVCLQCNCNRHSSDCDTATGTCM
NCQHNTTGPNCDRCIDGFYGDPRRGSQDDCQPCACPLLNQQNNFADQCVYSPTLENRFDY
QCLRCREGHTGKHCEQCAAGYYGNPMMRGGYCKPCSCSGNIDVLEPGSCNSITGECQRCR
NNAEGEKCDRCKPGYYGVALEGGCTACNCYINGSYSENCRSNGECSCRPRYTGKQCDRCQ
SGYGDIKNGCSRCRCNRIGSVNTPCDNVSGQCRCHNGVTGLKCDRCKDGFYRLTYEGCTD
CECYRRGTYNNSGRCHSMSGQCNCLPNVQGRKCDSCPTGYWGLDFNEGCKRCECNNVGAI
NAQCDVRNGQCTCRNGVGDRQCDRCLPGYYGFHYDGCKVCEPCNKEGHICDQQTGKCVCP
PNMSGPKCEKCDDNNWGIDNITGCKPCNCNTLGARRQQCNRRTGQCKCRKDFTGIQCDQC
QVGHFNFPVCDACNCNINGTMSDTCNDLSSCECDKRGQCQCKRNVEGQRCTDCKRNTFGF
DSTNPYGCTECFCFGKSQTCRQAPYVWTTVSLPVQRVSISQSASEEVQYRHGYPVIRTGV
TRIRVPPQSVNEMLYWSLPSEMLGDKTRSYNGKLDIIHYFETANPDEIDFRLMPSVVIMM
GNGFQIYYHDNVTLESSNPQGFSIRLHEYYWRHSSSIYPISRALLMVVLQNVEAILIPAT
NDGRAIYAELGPIGLQLAQPVRGVDITDRALGVEICQCPEEYSGDSCQNPGDGYYREKQN
GTIGNPIITIGISRPCQCYGHSDKCDSETGQCTNCVHNTTGKHCDNCAPGYYGVATRGSP
WDCAPCACPLIDRSNNFSPTCLNRGGKLVCTNCTDGYEGERCERCSAGYYGNPSIVGKIC
QQCNCNPEGSVSPECDLITGRCLCLPGIEGDKCNQCQPGSAVQNGTCTSCYGGCTGILLI
DLQELDAQFGGKNFTVPLPWKTLYKIENDTKMYRELLNAASFQSGSKFPQFENGTKFLEE
IAIRLMNRVEYVEQKSLETAEEVDGISKDAADLEQFIKEMFRNIRDDAEKLEDLVKKLIY
EQAGLDVSAALDEAKRIIRKIERRDFTQDDEKSKDEKWQARKLYERVKDLDEMNFNGSKV
DEKIKDIVRRLEDLKERSKEAREKAKRVIDEESSKLANQIASLEDKINDAKDYRDDADLM
DKINDAKDYRDDADLMDKINDAKDYRDDADLMDKINDAKDYRDDADLMDKINDAKDYRDD
ADLMDKINDAKDYRDDAALMDKINDAKDYRDDADLMDKINDAKDYRDDADLMDKINDAKD
YRDDAALMVDDANYYIKEARDHLDRLKENYIALERKESSLDMVLNILDSTYYDLRQNLNM
AEDSVRKAWQKARELDKQAQDLDRLFSKTRADAELPLRAAKVYQNIVDAIKLAENASRNA
LKAARDTANIANIDGLRNDVRESKEKSQRLLDTARMLQTRGLEDGLLYVQSDLKDLMMKQ
QSNRDMLNMINRDMDNLPKGLKRKIDEVGYRIANIGNRVDRTADQVGDTVDRINKELEPK
LDKLRDIDMKAMISHIRISSKNASENVIILKNLTDIVGKQSQAAKRLNADVSGKIIRLKE
KIRLARERANNMKLSLAADGECMRSYRSKATPSTANTIDFAFKLNKSAKKEEMLLLLVQK
SPTEYMAVEVRNKLVYFRWNVGSGEGFVIHEQPINLITEETVEQDHWYRVTAKRIGRIGL
LKVKSLARVASETDERNRSSAIGSSVLKFDSSSDVFIAGAPGAYNLPQNVTRNKFVGCIG
DVKIDDITVGVFNFKTNQDTCEACVEVPSEPGSSNIYNFDGTGYSEMKRGRYHAEKIAIS
FSFKTYWENSILHFSGDSMGDFMSIELVDGKVVLQYYMGGVSLGKGQTKNTYNTNKWVKV
YVDRKKLQALLTVDNEKIFIDAKPGLTGLDLKNSPMYFGGIPKSLSMTKFNKISTIETDG
LLGCMKDVSVGPISVDLQNLFTGNYVGMSAGCKDTGVRTVGFYGNGFSMYEGQSLSSGET
DISVSFVTKQPEALLLLSTDIPQSNYYSLSLKDGYVIAQFTVDAYDLQLKSNITFNDGAL
HNIGIIKDNKRVALMVDDKKHTEGRLPRGSDQIRIDAGGSLYLGGTPTGLTLGSNVPTKI
PLDGCLSNIIINGRLIAINNPKQYSRADIGRCRFDVVPPVRPIEPEETGTNNEFPFLATE
PAITNRKPNKRTTTKPILTTRPSLTTTTRNPRRTPETDKTTSANKLEVTTTPFPESTTPT
LCGQKQDYGYQQGGSSFGNTKASFAQVKVKRRDVSKSFNISFEFRTYYENGLFAFITNGE
QSDYIAAQLKSGYLEISYIRTVPTTTQSRQTYNDGRWHSVRITKERKDLMYIIDNRETKR
TRIRAKLDIDAPIYIGGLPNNFDLKTDQVVRNSIRGCVKNVYINKDLIDLSDTKIISGVG
QCYKDVERGAYFSRSSWGAYRKNVRVTKDWSIELSFRTGDKDGIIITSSSDDGQSALAVE
LVNGQVQFTVKNGAKIFRAKSEIDTRFKYCDVNWHMVKARILGNVIGLSIDNEEEVLSNS
PGQFEYMETETPLFIGGTQFAFKDQAATSVNAGFMGCIRDIKIKNKPLDWYDLVEFGSVR
RTACPIF
Download sequence
Identical sequences V4CS81
XP_009043900.1.39240 jgi|Lotgi1|227981|estExt_fgenesh2_pg.C_sca_10334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]