SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|228160|estExt_fgenesh2_pg.C_sca_10678 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|228160|estExt_fgenesh2_pg.C_sca_10678
Domain Number 1 Region: 293-374
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000262
Family Integrin beta tail domain 0.0029
Further Details:      
 
Domain Number 2 Region: 17-135
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000398
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 208-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Integrin beta EGF-like domains 0.0061
Further Details:      
 
Domain Number 4 Region: 252-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|228160|estExt_fgenesh2_pg.C_sca_10678
Domain Number - Region: 182-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Integrin beta EGF-like domains 0.04
Further Details:      
 
Domain Number - Region: 141-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|228160|estExt_fgenesh2_pg.C_sca_10678
Sequence length 376
Sequence
MDMDYRLLRNEPLSTMHSKRIAPQQISLNIKKASGKETEVQFEATAAKRWLATKISFPRR
KYSITMTSTCRFRWRDSGRGRCSRTRRGQTLTFTLKIRVLDCNDGNGRITVSIPGYTQDK
LNIEIRSSCPCSCEQNKERNSAVCRGNGHLSCGTCECSDGYFGQQCECMGYERDTCRARP
DSTVCSGRGNCVCGMCECQAGFEGQHCECNNENCNWFNNSICGGSDHGICNCGECTCKPE
YTGTACELPMSTDGCIAPNGIICNGHGNCIGNTCQCRGTYRGRTCDQCPTCIGQCSILWP
CIQCTIFQTGELTREDCYYQCRQYGIMPVDSLERRESSRLCMFRDDDNCSVSFMYMFDED
GELVVEASRQKNCARQ
Download sequence
Identical sequences V4BD05
XP_009044231.1.39240 jgi|Lotgi1|228160|estExt_fgenesh2_pg.C_sca_10678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]