SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|228404|estExt_fgenesh2_pg.C_sca_20388 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|228404|estExt_fgenesh2_pg.C_sca_20388
Domain Number 1 Region: 324-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-49
Family MAM domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1876-2035
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-49
Family MAM domain 0.00021
Further Details:      
 
Domain Number 3 Region: 2379-2540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-48
Family MAM domain 0.00028
Further Details:      
 
Domain Number 4 Region: 1364-1526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-45
Family MAM domain 0.00036
Further Details:      
 
Domain Number 5 Region: 3898-4058
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-44
Family MAM domain 0.00025
Further Details:      
 
Domain Number 6 Region: 5544-5702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-44
Family MAM domain 0.00033
Further Details:      
 
Domain Number 7 Region: 3224-3382
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-44
Family MAM domain 0.0016
Further Details:      
 
Domain Number 8 Region: 2038-2197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-43
Family MAM domain 0.00092
Further Details:      
 
Domain Number 9 Region: 675-837
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-43
Family MAM domain 0.00047
Further Details:      
 
Domain Number 10 Region: 2219-2377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-43
Family MAM domain 0.00041
Further Details:      
 
Domain Number 11 Region: 158-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-43
Family MAM domain 0.00044
Further Details:      
 
Domain Number 12 Region: 6113-6271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-42
Family MAM domain 0.0024
Further Details:      
 
Domain Number 13 Region: 6959-7116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-42
Family MAM domain 0.003
Further Details:      
 
Domain Number 14 Region: 8049-8207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-42
Family MAM domain 0.0021
Further Details:      
 
Domain Number 15 Region: 1199-1355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-41
Family MAM domain 0.001
Further Details:      
 
Domain Number 16 Region: 2626-2784
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-41
Family MAM domain 0.00092
Further Details:      
 
Domain Number 17 Region: 5705-5866
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-41
Family MAM domain 0.0007
Further Details:      
 
Domain Number 18 Region: 4465-4626
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-41
Family MAM domain 0.00068
Further Details:      
 
Domain Number 19 Region: 3546-3704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-41
Family MAM domain 0.00076
Further Details:      
 
Domain Number 20 Region: 484-647
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-40
Family MAM domain 0.00075
Further Details:      
 
Domain Number 21 Region: 4060-4225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-40
Family MAM domain 0.00073
Further Details:      
 
Domain Number 22 Region: 1714-1872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-40
Family MAM domain 0.00072
Further Details:      
 
Domain Number 23 Region: 5019-5191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-40
Family MAM domain 0.00042
Further Details:      
 
Domain Number 24 Region: 3723-3896
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-40
Family MAM domain 0.00045
Further Details:      
 
Domain Number 25 Region: 6538-6699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-40
Family MAM domain 0.0017
Further Details:      
 
Domain Number 26 Region: 5194-5360
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-39
Family MAM domain 0.00052
Further Details:      
 
Domain Number 27 Region: 5379-5540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-39
Family MAM domain 0.0022
Further Details:      
 
Domain Number 28 Region: 1005-1165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-39
Family MAM domain 0.00062
Further Details:      
 
Domain Number 29 Region: 2832-2997
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-39
Family MAM domain 0.0011
Further Details:      
 
Domain Number 30 Region: 844-1002
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-37
Family MAM domain 0.0023
Further Details:      
 
Domain Number 31 Region: 1530-1698
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-37
Family MAM domain 0.002
Further Details:      
 
Domain Number 32 Region: 5904-6062
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-36
Family MAM domain 0.0011
Further Details:      
 
Domain Number 33 Region: 3386-3542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-35
Family MAM domain 0.0013
Further Details:      
 
Domain Number 34 Region: 7828-7995
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-35
Family MAM domain 0.0027
Further Details:      
 
Domain Number 35 Region: 4853-5017
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-34
Family MAM domain 0.0012
Further Details:      
 
Domain Number 36 Region: 7383-7547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-33
Family MAM domain 0.0026
Further Details:      
 
Domain Number 37 Region: 3051-3215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-31
Family MAM domain 0.0063
Further Details:      
 
Domain Number 38 Region: 8255-8416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-31
Family MAM domain 0.001
Further Details:      
 
Domain Number 39 Region: 7612-7778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-29
Family MAM domain 0.0014
Further Details:      
 
Domain Number 40 Region: 4684-4846
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-27
Family MAM domain 0.0026
Further Details:      
 
Domain Number 41 Region: 6327-6491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-26
Family MAM domain 0.002
Further Details:      
 
Domain Number 42 Region: 7173-7334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-24
Family MAM domain 0.0015
Further Details:      
 
Domain Number 43 Region: 8-126
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-24
Family MAM domain 0.0048
Further Details:      
 
Domain Number 44 Region: 6753-6909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-24
Family MAM domain 0.0072
Further Details:      
 
Domain Number 45 Region: 4264-4416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.55e-17
Family MAM domain 0.0046
Further Details:      
 
Domain Number 46 Region: 4422-4461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 47 Region: 2791-2828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 48 Region: 6498-6535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 49 Region: 7134-7173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 50 Region: 8214-8252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 51 Region: 6067-6105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 52 Region: 3015-3052
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 53 Region: 7785-7820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 54 Region: 6288-6327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 55 Region: 4647-4685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 56 Region: 8490-8528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 57 Region: 2543-2587
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000965
Family MAM domain 0.01
Further Details:      
 
Domain Number 58 Region: 8429-8465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 59 Region: 6714-6753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 60 Region: 6914-6952
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 61 Region: 7340-7377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 62 Region: 8011-8049
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 63 Region: 7578-7612
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000903
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 64 Region: 8576-8613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.025
Further Details:      
 
Domain Number 65 Region: 2594-2627
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000707
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|228404|estExt_fgenesh2_pg.C_sca_20388
Domain Number - Region: 4225-4265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 5874-5904
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00034
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 8531-8561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00615
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|228404|estExt_fgenesh2_pg.C_sca_20388
Sequence length 8714
Sequence
MTFSHIPITGGYVFIESSAPRAPGHLAWLISEQFQPFNSGVKCFNFWYNMNGNGIGTLNV
YIDDAANTTHTLLWSQTGKKGTAWLNGQTPIPRQSKAYMLRFEATRGPTYYGDIALDDIS
ITPFKCNVQPAAADPKTMTQPPVTIGSTTPAPFVKQSQFDCDFEKDLCTWTQAKDDIFDW
TRAQGPTGSRLTGPTNDHTKQNNNGWYMFIETSAPRKVNDTARLVSMTAQAKQAYCLQFW
YHMYGPHVNQLGVYLKINGKIGSPVWKKGKSQGNKWVFAEYQIANQSNQFNIVFEGVRGP
SYRGDIGLDDIKVLTGACPIPDQISCSFEDPKICGWTQGKNDKFDWTRHRGRTGSSFTGP
TVDHTVGTSKGYYMYIETSSQRNGDSAHLISPQVTSTDVKCLQFYYNMYGLHIGTLNVYL
LTSQGNTTVWSKSKNQGTAWIVAQATLNPTQAYQVVFEGVRGVGYKGDIAIDDVTVSNGP
CSLPGNCDFEKRFCTWTNPTAGDNFNWIIGQGRTSSRYTGPSADHTVSTSTGHYAFIESS
SPRKPGDRAWLKSMQFSGSKAPKCLSFWFHMYGVTVGTLNVVYLPTDGSANSTIWSLTTD
HGNLWIQGRVSIASIKPYFIIFEGVRGSGFKGDIALDDITFTSSYCTVLPQDATAGVVTL
VPTPSPTPTVPSVPTPYDCNFDTDFCKWNQSTHDDFDWSRGNRFTSSGGTGPTADHTQGN
SQGYYAFIEASYPRKENDTARLYSLPIGFTQGSCISFWYHMYGPHIKQLSLYTIPVDFSN
NGSKVWTLTGSQSNAWKQAQVDVTSQNHFRIVFEAVRGNGYLGDIAIDDIHFTRTPCKKT
TVRMCDFEDNKICGFKQRTDDKFDWTWSTGRTSSSFTGPASDHTYGTSKGHYIYTEASSP
RRSGDNAKIESVPLIATSGQCLSFWIHMYGSNMGILKLWQNDLLTKKSKIIWTQSGNHPN
RWIPIFQTLKSNNNFTIMFEGQIAGYRSDMAIDDLKLNEGGCPSAGNCDFENGLCGWSNP
SGSADKFDWIIGRGQTGSQFTGPTFDHTQQSGLGHYMFIEASRPQKKGDFAYLESPYMNG
KTVGCFTFWYHMLGDGIGSLQVYTVVGSQVNFVWQITGNQKDQWNFGKIPLKLTSMFKIR
ISGTVGTNYKGDIAVDDFVIQADVCNLQPSSADPKTQTTTSTMPTSTVSPSPTPVATVYD
CNFEQGFCKWSQDKDDVFDWTRTQGGGRTMGPITIDHTTGTSKGWYAYIETYKKHYNDTA
RLVSASINDASPRCLSFWFNMYGAQINALNVYYQSGGGARTILWTRRGSHGNTWYAARMT
IQPPTPYNVVFEGVTGRGYRGDIAIDDLRISTGACPGSVSYKRMCKFEDKNICGYTQNSD
DDYDWTWKRGRTTSSGTGPSTDHTYRTPYGHYMYVESSGRQVNDSARITSPEYQNPDGSE
LCMTFFYHMYGKSIGTLNVYVKDRTQSTASLAPVWSRAYNLGNVWQEGNVNIYQSSDFHV
VFEGIRGTSYTGDIAIDDVSFKAGECQKQGYCSFENDWCGWRNLRPGDNFDWLRGRGRTS
SINTGPSTDHTTSKDTGYYLYIESSRPRKPLDFARFLSPVFKAAKTDVCFSFWSHMYGSD
IGTLKVSVLTNTSADTTTTEATIWTLSGETGDQWFSAQAPIPAKFTQNPFMIAIDGIEGT
GYQGDIALDDFAVAYTSCSIVPSYADPTSAGTGNSDCAFDDQTICDWTQSKSDKFDWTIN
NATTESRGTGPSADHSGMGFYLYLEASNPRKLNDTALLVSPKISPSTTSYQCFTLWYHMY
GPHIGTLNVYTTINGQKTLSWTRSGTQGNQWQQLQLSINSSTNYQVSIEGVVGKGWLGDI
AIDDIHIDSDQCPKSKTCDFETDLCGYTQDTNDQFDWTRNIRSTLSYATGPNGDHTEGVK
SGHYMYTEASRPRKFGDIARLISPTYSQTGTECLRFYYNMYGTTMGKLNVYLRSNGQNGQ
PVWKLSGNQGRAWLKAQVTLSAVASKYQVVFEGQIGSSYYSDMAIDDITILPDACPKPAS
CTFENDICDYTNVKGDDFDWTRGKGATNSHFTGPQVDHTTNSVFGYYMFIEASNPIQTGN
KAWLMSDPIPATQASCVRFWYNMYGSGIGSLNVYTVIPSMQPQRVFNVSGNKGNLWLMAS
IDVSSPKTFQLRFEGVKGKDYRSDIGIDDISVNVGTCASIPVTLTPPVTTPQPTAATLIG
CDFEKNNLCTFTQDTTDDFDWSLNKGQTGSSGTGPPFDHTQQNNKGHYIYIETSGQKTSA
AARIISPTLNTQSSTCVTFWYHMLGRHVNSLKMYIKKGTTLGLPEWVKTGDQGNKWVYAT
VEIGPQSGTQMVLEATKGTGYQGDIAVDDIKILNGPCPAPAFCDFEDTNLCGYRQDQNDD
FDWTRQSQGTSSRGTGPTNDHTYGTRIGHYMYIEVSGKTLSGAIARIFSKDYPPTSGKCL
SFWYHMYGGDIGTLNVYLGKSNKKGTPVWNLFGDQGNMWKQGTVEVTSQETFQIIFEAIT
SGGYRGDIAIDDIQLSDGTCLSKASCDFEDDFCSWTQLASDQYDWIRNSGSTPSRGTGPS
KDHTLGSRTVPRNQNFSCGDDANTIIPMSKVCDFIRDCPNILDELNCGDCDFEADTCGWN
DDSTGSFQWSRGSNQTATSNTGPAFDHTFNSLKGSYMYVDASLGKRGSIAEIVSPTLGDC
SSTCQLNFWYHMYGRGIGHLTVVLREGFEDTILWTKIGNQGNKWNQVVVDIGRVSRSFKI
IFQATRTYSVLGDIAIDDVDFINCNYSPVKKTCSGNEFRCKRGSCVSQNQVCDFADDCGD
GSDEMNCQNYQPRCDFERSFCQWSQAKDDDFDWIRTKGETASRGTGPTRDHTKGTKSGHY
IYIETSRPQKQGQKARIYSPTFSRTLPSPPGAQVCTLRIFYHMFGRSTGALNIYTRQTLG
STMALKWSKSGNIGDYFERLDLQLLETADFQVVIEATVGSSYLGDIALDDISFSSGCSVT
ATTLVSGSPLPATTSSPCSVSQFQCNDGNCISQQFVCDFTPTCNDGSDELMCGTCDFERD
LCGWTDMSTGKYRFDLGSGASTSQATYHGPATDHTTNTNKGRYIYQKSGSGVFKTRAKLG
SPVFGQIGPACQMKFSYHLRGSGAGNLRVLVQNKINQRDVTTLFGITGDQGNTWHTITVD
VGFHNAGYQVIFDSMPSPSFGSYDVAIDDVAFIGCSASQVYNGSLNCDFEKGFCGYHQDT
QDDFDWTRTNTSSPTHGTGPDRDHTSGKGYYVYIETSAPLRNGQDAVLETSYQNPTKGMC
LHFWYHMFGAHVNTLNIYMQQFGNSTKSLIWTRTRNRGNQWFSDQVTLISDTKYKVMIEG
IVGVSWQGDIALDDFTLTTGVCMPSKSCDFETDMCSFDDDGSNGYQWVRHRNGSSVGNGP
VVDHTTGNSDGYYLYTVQTSTSQGNTARIASQTFQGMPQKECLRFWYHMQGSQTAVLNVY
VKTGNMLNSPVWSITGDSGDMWMAGYVTIQTSGVYQIAFESLKGQTNSDISIDDFSITPG
PCPAVANCNFEYDMCGFINGQTKSDVFDWQRSAGGTLTYGTGPSVDHTTGTDQGFYVYAE
ASGRNPKERAWLFSPYLKPTTKSCISFWYFMYGRDVGALRLYMPMPKKTILLWNKTGDQG
NQWLYTQVQVTSRTGFQFTFDAEIGNGFHGDIAIDDISYYSGVCMQPTTSTVIPTQNTVT
YGPTNVDCTFDKNTICSWTQDSSDKFDWTLMNNATASFSTGPAADHTQQNNKGYYIYTEA
SNKKTNDTARILSPDINVDTVGKCLMFWYHMYGSRVGKLNVYGKQGDSDPLTSPLWSRFG
NQGNQWVYGDLYVTPQTLSKPQQGATTIKLVFEGVMKSGYTGDIALDDIKMKDGACPTDI
KCDFEASDICGYQQDTTDDFDWTRNHGSTSSSSTGPTTDHTYKTPNGYYMYIEASSPQKS
GEKARLIVPKLPKTQGSCLRFFYHMKGMGIGTLNIYIRQYNRMRKVWTRGGDQGNIWRAT
QINFNSYATYDILFEGVIGSSYRSDIAIDDVEILPRSCAFPAGCDFENDMCTWINNESSD
DFDWLRGKGSTGSQGTGPSTDHTLGTRNGYYLYIESSRPRVQGDMARIESEVLLMKNGAC
MTFWYHMYGQSIGSLNIYVNPLNISDSVPLNRIWYREGDNVNKWQNAAISIKNVGEYTIQ
IEGVVGTGYTSDIAIDDIRINPGLCSTTSATGSDFKCLDGSGTVTSDKVCDFVSDCADSS
DELNCGNCTFEKDMCKWSDQSTGSYSWIYATNGTSTLKNAPQNDHTFGNSSGHFSLVDYS
TGRNYQMSLLKSPTLRHTSSSCQISIYYYALSRYSYLDLSIQVGYEITLIKRLNVGSLVS
SWASATADIGGMRGDFNILIESRAFFAIDDITLTNCQLPPVQKSCPSNMFRCQRGSCIPK
QQLCDFTDDCGDGSDESDKTCVGAVGCTFEKSACVWQQSKIDKFDWLRHKGPTSSSSTGP
TRDHTTRLSSGYFMYIEASRPRKNGDMAQLISPTISPASTSDQCYFTFYYHMYGKGTGTL
SIFTWYKIGGARQVLWTKKGNRGDFWERASVQLTRSTQFQVVIEATVGTSYYGDIAIDDA
IFSPGCKLFGVTLPSAITPPATTAPTVSNCPNGQFQCKDNNGCIPMSQYCDFNIDCLDKS
DEAMCGACSFEQGSCGWIDASTGKYNFTVLQANPNAIKTDHTLNSANGHYAFVEGSRGLF
FSPAKLQSPPLPAASRYCTMYFYYLMNGQNAGKLSVSVNVNGTSKTVWSVYGSQNSFWRR
GIAYIGRTFGAMTKGSIVQFMATPARGFTASATSDVAIDDISFVRCDPKIYPPDLKCSFN
VDYCSWVQSTTDDFDWTMGNSTIKSYGTGPSYDHSYRKNGNYVLMRSRGQRKGDMARLET
ATLGPTTSTGHCFKFWYYMYGSGVSSLTIYQLGSDGTGQFTNSTIFWSKKGSQGDKWIQG
ARTIYSNTEYMISIEGLVGGYRGDIALDDFTVSAGRCPASHTCTFEDNNFCEWDQSTTGQ
FDNFDWSIGSRTSSRGTGPSVDHTFGSSSGHYAFIEASGRKEGDKAVLIGPLLSRATSGN
TFFGGKCLKFYYHMYGPTTGSLNIYMRNNGSSTSNLLWTESGDQGDVWRRGEVSFRGNRL
TPFRILIEAVRGSSYTGDIAIDDLDVTQGYCPAQGACNFEDDTCGYINVQGEDDFNWVRD
YGGTPSSNTGPSTDHTLRSSAGYYMYIETSGFATKPGSKAWLQSETIQGTSSSSSSSSFC
LTFYYHMYGAGTGALNVYSRVSDNPLSLIWSVTGNQGNVWHKAQATINEYDFAIIFEGVK
GNNITGDIAIDDVNVGKYACYRVTPITQPTVTPTPTYQPSNLDCDFELGFCFWKQDKVDD
FDWSRHAGETDSKFTGPSADHTIGNNQGNYIYTEVSRKKTNTTARLISPSVTIGTQGICF
KFWYYMFGANINRLSIKVKNGVNETTVWTRAGNVGPSWKYFQIFLQNMSGPSNIIIQGYS
GQYYMGDIAVDDVSMNQGNCPSYAACEFEGGMCGYVQDVDDDFDWKLQSGGTTSGGTGPQ
TDHSFKTKFGHYVYIESSNPQRPGYKARITSPIIQPTTGSCLQFAYNMYGRTVGTLNVYQ
RYGSGLGHPIWSSSGNQGDEWHIRQINIQSNQQFAITFEGIVGNGYTGDIAVDDIHILSR
MCEPSGSCDFESGLCEWENVLTGDDFDWVRLKGSTTTTNTGPGKDHTTGNKYGVYLNMES
SAPQKPGNKAWLQSPPFANATTKCMSFWYHMQGTTMGTLNIYKLAYGTKKENIWSKTGNQ
GSDWLNARLTVSSTNGDYIIAFEGVVGSGFSSDIAIDDIYIQDGDCSTLPPQLTFNCPQG
NVVNGDKVCDFYPDCANGEDEVFCGYNCTFDNGTCKWNNTKQSSYSWTRFRGATPDSNTG
PSMDHTTLTASGYYMYVDASKGKNYAYAQYESPTLSASATSCSFSFWYHMYGKQVGYLYV
VKKEGQTSTTLWNTKADHGNKWNKALIPIGRTQAHFTVQIVARRSYGVLGDIAIDDIQFS
HCDLPRPNGPCQASQFQCQNQVCIENFRVCDFVDDCGDGSDEIDSKCSSYKLCNFERGIC
DWRQDRNDNFNWYRNRGATRSMLTGPSYDHTLMNPRGYYLYVESSQPRLPGDKGRLMSTY
FQVSSSDTCSLRFYYMMYGKDCDTLAIYKRTTIGGGMTMLWKRTGEIGDYWVIQVIDIKE
PQPFQIIIEGTVGKSYYSDIGIDDISFTPGCVPYTGTLPTGVPMIGTTPPNPCGVGKWTC
VNKACIQAQGLCDFRNDCTDGSDEANCGACDFEKGTCGYVDISTGIYKWERHNGTTKSSV
SGPSNDHTFGNSGTGNFLFVDSTKGSNFGRAVIQSHAFGPTDANCEVQFWYQKTGTQRGV
MQLYLVPPNVRGDDLNNLILLWTAFGDKGKNWVQASSGIGLRQAGYSLSFQSLQMQKSGD
MAIDDISFKNCALKQNQSSCLPNQFHCKSGPCIDNSQLCDFTDDCGDNSDELACMSYPER
CNFEKDTCNWIQEKTDNFDWRRSYGKTTTLGTGPDLDHTYGNTTGNYMYIETSWPRKPNE
TAVLSSQVFSPTTSGNCKMRFFYYMFGVQVNSLNIYMKSVVVGPKNPVWTKQNSVANEWK
KGVVTLSSTVPFRIMIEGVTGTGFKGDIGLDDISFTPDCKIAPRSVTLPPSITTPGPCGI
GKFQCATSQKCISSTAVCDFREDCDDLSDESSCPKTCDFNTDLCSWKNVIGVNNLNWTLM
SAPMKDHTTNSNNGKYAIIQASSTMKYGQAARLSSPLYFRAGVTCQFSFWYAINGTGFYP
FNLIMSSGGSDRVLWKLNRINNVANQWHNVTVDLPSCSSEFSMIFTAQFFTSRTPGSYIA
IDDVAFVNCGLPDPQPTCAADQYRCGTGHCIDQKFRCDFATDCCDGTDEKTDTCKGYNMC
DFEVNLCSWTQDTNDNFDWSRHSGRTTSFGTGPTVDHTTDAAVGHYLYIESSTPQKLNDV
ARLLFNLPPSKGKNCELHFWYHMYGTHIGGLNILTRTIGGKEKTISSLAKNQGNSWMRQS
VNIYNNVEFQVIIEGKVGVGFKGDIAIDDISLTPDCGAGGIHPLLPSTTTPQPTFPPCAS
NQFQCKSDGKCVSLSQICDYSKDCSDGSDEMYCPSTCDFEQNNCDWNYTAQPFDWLRSNG
INTANQRANAPLNDASSGSPNGHYVFVNDQTGGSPNFKKAVLTSPSYASAKSDCKVRFAY
YIHGQAVGYLRLKILEDGKTSTLWRLSNQPGSEWSYVTVGIGRRADTFKLSFETSSLQKF
SGAIAIDDIKFMDCAMPPRTGNCLPGQFVCKNNACVDQDKTCNIIDDCGDASDEMDNDCQ
STIQFDFEADYSDLSQGVDGTDDDFDWVLWKGNTPTSFSGPDRDHTTGLETGHYMYMESS
APRKYGQKSWLLTKPIQIVGDEGCSLRFFFYMYGIHINQMAVYYRSYNSGPPTKQVWFAS
HNQGAYWQNAVVKFTNDSPFQVIFEAVVGDSYMGDVAIDDISFTAGCQYSTEALPTPPPY
LTSSIGPTASTAPHTCDLSFQINCKSDGRCIDLKQLCDFTSDCADNSDEASCASSICNFD
DGTTCGWMINSTSQAGVGETYRWKVDIASSFTGQDFVPSTDHTSNSPNGYYLWVDSSPGS
YKDVTQVHTPPIGQTGPQCKLDFWYFMNGPSVGSLEVETKYGDQSTMIWSNNGNHGTAWQ
HAVLLIGSRTDFEVIIQSKRGRTYRGDIAIDDVKFVDCVPPMPMIGGCSSDQLTCGNGYC
IPIVQKCDYANDCGDNSDESVIQCDQTYKGRCNFENLLCPYWTQLINDNFDWTLSNGVTK
TIGTGPSNDHTTLSNKGNYLYIESSYPHKAGQVAKLGSQSISGMSQDCSLRFWYHMYGVD
IADLTVYKQFDYGGDGRTLIEQISGNQGDIWLRREVDIANEAGDNRDFMIVFEGKVGKGY
HADIAIDDLSLTPGCEDGGPLTGQPTAPSVTNAMCDDDTYKCKNGKCFSANQQCDFFNNC
GDSTDELTCGTTCTFENGECGWRNNQRDNLDWQTQKGPTSSKNTGPGADHTTGTAAGTYL
YLESSFHSPGDFAILETEEYQISGAACSMSFWYHMYGTTVGTLSVLLKTEVDGIISKWSK
SGSQANQWNQATVTIGSKRNFVVMFKASIGTSYRGDIAIDDVQFNNCEYSSKSKSCTDRE
FMCANKQQCIPIKYKCDGQKDCQDNSDEASCLSVNGDCHFDSSNWLSYCKWQQSTTDDGD
WLLAASSQNSGTGPKVDHSATAGGQYIYMDSRIQSVGDIVSIASPPFIASIGVCYVRFYY
YMSGSANIGPLRVYTVNSDKQRELMWSMTGNKGAAWQYANIPVGNSKNYSVVFEAEHADG
KQNDVAIDDVTFTQGCVTGAIYNASRQFDCDSHHFYCTPTKQCLPTAWLCDGVTDCPDGV
DEPNECKGISPVTGGPKTLPPTTPAPVTAATNTCGYGKYTCADKVCISAAFICDGVKDCS
GGEDEYICGNKCKKGYYKCEYSQNCIKISTQCDGTLDCTSDRYDTIGQDEAFCNVGCQNN
PCQNGGTCTVGIKGKFTCKCPTDITGGRCQVKLGVNSPQTGSSGKWPIPVGIVLALVFIA
CFLGLGYYLKVKKNWQFKLPAPLLRRQVSSAGVENPVYDYGSGNIQMDDIHQLEPPAFKA
DDPSTSITNPLYSD
Download sequence
Identical sequences V4C844
XP_009051709.1.39240 jgi|Lotgi1|228404|estExt_fgenesh2_pg.C_sca_20388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]