SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|229585|estExt_fgenesh2_pg.C_sca_80179 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|229585|estExt_fgenesh2_pg.C_sca_80179
Domain Number 1 Region: 120-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000325
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 43-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 183-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000733
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|229585|estExt_fgenesh2_pg.C_sca_80179
Sequence length 478
Sequence
MQLSKVSGVILSALLFCTIEAYTTPADYTNDDSNYEVTTDSVIDYCDSMNICQNNGTCSY
YTHYYYGICYQCDCPYGYTGKYCGYSYESLVNPVVNLRYNHRESLAISNSFPPIPRDYRH
NPCSFNPCLNGATCYSYRNGCYKCHCPYGYEGYNCEKPFHDVTTSDTNTTPDSNYEVTTD
SVIDYCDSMNICQNNGTCSYYTHYYYGICYQCDCPYGYTGKYCGYSYGFNNYQTTSSGLT
ENIVQVSCENGYFDIEVDMELFRQHHPNVSSIYMYFGYCRVYSYNDYFSFGHYNLRSCGS
TRKETWDKIIYSNTIYVMDDSVITRDGGSYLVQCKMEREAYGEGQCSVDSTTVIYNTTFG
FKTFEFIKEKGEIDIVCRVFICTEDDNSYRCTRRCSGYRKRRSTDNDDKPISIYEGPFVF
AADDEADTTTAIAVGTTAGVVAVVAFVAVTIKVVAPKVAVAAAGYSSVANAAPAVATV
Download sequence
Identical sequences V3ZNM0
XP_009065203.1.39240 jgi|Lotgi1|229585|estExt_fgenesh2_pg.C_sca_80179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]