SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|230169|estExt_fgenesh2_pg.C_sca_110104 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|230169|estExt_fgenesh2_pg.C_sca_110104
Domain Number 1 Region: 34-171
Classification Level Classification E-value
Superfamily C-type lectin-like 4.98e-28
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 2 Region: 211-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-24
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 2460-2634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-19
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 438-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000249
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 5 Region: 343-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000837
Family Spermadhesin, CUB domain 0.0082
Further Details:      
 
Domain Number 6 Region: 618-681
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000118
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 3472-3626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000116
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 8 Region: 3308-3479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000301
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 9 Region: 164-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 10 Region: 1029-1093
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 11 Region: 2948-3098
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 12 Region: 1805-1843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000287
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 13 Region: 669-736
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 14 Region: 2246-2289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000625
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 15 Region: 3667-3828
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000796
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 16 Region: 3021-3048,3077-3206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000137
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 17 Region: 2371-2408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000898
Family EGF-type module 0.016
Further Details:      
 
Domain Number 18 Region: 2404-2444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 19 Region: 2233-2369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000116
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 20 Region: 766-870
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000155
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 21 Region: 1884-1926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 22 Region: 732-794
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000222
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 23 Region: 3142-3298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000412
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 24 Region: 2166-2203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000641
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 25 Region: 1768-1809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.015
Further Details:      
 
Domain Number 26 Region: 967-1037
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000598
Family Complement control module/SCR domain 0.0077
Further Details:      
 
Domain Number 27 Region: 1847-1883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000727
Family EGF-type module 0.019
Further Details:      
 
Domain Number 28 Region: 552-628
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000089
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|230169|estExt_fgenesh2_pg.C_sca_110104
Domain Number - Region: 3861-3898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000548
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1479-1588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 2132-2172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 3821-3854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0671
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1740-1767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|230169|estExt_fgenesh2_pg.C_sca_110104
Sequence length 3987
Sequence
METRVHVSCPYHFIRTIRLNLHVNLSLSEEDYKGQVSLVCPPGWTLSDIKCIKPSPPSVQ
LSWNAALKVCQQDGAHLAEIRDYKSNVELGNFANSQSFSHFWIGLNAPHTNNSVEWSDGS
PTSINEGFWSDQQPDLTKGRCVSYNTVSNENRWSFKNCETKQPFVCQLPACPSGSYHCSN
GKCINNKWTCDGQNDCGDMSDELDCKDKSICSEYQTGTSGQISSPGYPTGSYPNSATCLW
TIESPIGTNVRLQITAFETEIDKDEVTIYGGGKTLTKSQIINRLSGIFVNVPKIFISPNN
YLKVHFNSDNTGVKRGFQASWTVVKQDDESLIATQITQNLAPSSSPQSYLGNQESTWLIQ
SQLSRDVVTLEKMSLDLGEGDVVEVRDGRTVDDVLLATFTHAGGPRYVTSTGNWLMVTFK
TGLTVNNQHTGFQFQYKQGCDYEYRESVGELGWPGHGIVNYPNYQTCTWTIKTSEPSLHL
VFDSDFNLDNSDYLEVYGFQDDSGIALHSGAGYTGTTTPPRIVTTNGAFFLRLKSNAIKS
QKGFKAKYSTDCPTSEFLNFQQAPAPGDTGFGVRTVISCKPGFRFNTQELAGQSEFTLEC
LYSGNWNVRTIPKCEANYCGFPPTVDHGKVISGTGIGFGSTVVYQCTDGFLPATPTTATC
NINGQWQNVPTCREQTCPAPTGNNGLLRQVKTENGDGTTFGSIVQYDCLAGYKIVGVPIS
MCYNGTYTATTPTCEALNCPLPRVANADVRLQGGKPVAVRGDILTMTCKPGFTLSSTTQM
ICGTDQQFTNLASCLDINECNNGSPCGQQQCVNTHGSYHCRCLDGFTSTPTGGCQDIREC
QSSNKGGCSHTCNELEGGYQCSCPLGYFLITRDAEQGYYLPQGETGMNYGDTYYFNHTCL
PGQCAFTSSNGANVTTPSPVKGNDAVQINCPASPGVPAYIKTIPCVYDVSTNSFKLTTQD
FSCKAVSCGMPELVPGHVSPLLISSTKAGVGSFQFQCLQFYQLDGLSDQGDTTVRCLSSG
YWDFGRLRCLPQRCSDPGTPLGGQRISVSYMFNDRATFSCPRSGYQLTNSQPLECQQNGA
TLNWSAALPQCRDVEKPVFVNCTTQPIRLKQYEKISYTIPTATDNNNILLSLTVDKPWFR
PGIPVAESTVVSYTATDHAGNQATCNITVIVQDELSPTIRCPESRRVQIERSSDVVDLSW
GMNDMVKLSDNVAVETLVFTPSSIRLTQSDVGTVQTVTAQASDAAGNMASCQFQISIEGL
CSPNSLSNPINGNKQCTERADGTGYDCTISCKAGFFFQTSYPSELFTTSCNFGGAWTVPD
IPHCTEPQHVSFDLDTEMFYNTSDASVLSSSCINQYNNEIRTRLFDARSHFNTECGITDV
SITVNNNITINYDRQFKVFFRVMFRSTKHIPSVFTNCVQQVTTAIKLIRNDPDASLLSNL
HTIDLVGCSNIVLNTRNSRAKDFCSQPSEVARRVDNIYACVPCPPGTIAEVSICRKCPVN
TYRGGDLQSACTPCPTESATYGDGKTSILDCKPVCSGNLMSTNGLPPCMECTGETYRVNS
TYCQLCPANTKFVPTPLYPECTNPSCTYIKTDNQVMSGPPVNNISPTDGNMQECEASCDS
YRVFGGEECIGFSYNKVTKFCLLLTLEGTLSPNSTYDFYRRSCNYRTDKECYCGDACPIG
SYSFTGNQPDCRLCPQGYYTNTPGSNQCLECPLNQTTTAEGATSCVDGVPLLCGQCSSSN
TESCTVQKHLAYCQCRPGYTGLYCETLINNCLSQPCYYNTQCTNFPGRFDCACPTGLSGD
RCEFNINDCGPTTCQNGGVCEDGINDYICHCLQGYSGKNCQIQDPVCTTRPQCINGGNCI
PVNNVLRRCDCPVGYTGPTCAINSDECASSPCQNGAQCTNRPGGYTCSPCPEGYSGQMCN
IPESQCRNTDCGGGAESCMDDVTTGLPRCICQAGFSYGRYCQYELSTETASTSGNLGQPF
TNVGPSTCMAACESTTNRVNCVGFSYNRNSRSCQLLTQSYTTSTVTNNQLYIKACSHPAD
DFWTPWFNVDKTSSGTETETRVGLQTYDINICSSTTPVAVECRNVNGGSITGSQCSVNGF
QCSTGNCPNVEVRYRCSLSRVFKDTQCKRQDLCSESCDSNHVCHVDRDVVTCKCKTGYKG
LQCSEDINECTDLSIDCNTGQCINTPGSFSCQCQNDFTGSRCQNGPVPCDKNNCNPLNTA
NCINTGTTTSRCECKPGFKGATCGESIDSCDSNPCIHSQRCDNLVNDYTCICEAGWTGRR
CETLIDTCSSTSQSCSDRGTCFSLFNDYYCKCNNSTNYGKTCELTENICSVIDLCYNSAA
CSSGNGETKCNCAPGYMGMSCQIKEDFNCETSSPCVNGGTCSSQVTGFKCSCPPGYGGDK
CEVDVNDCSSNPCSNAAQCVDLIDSYYCQCSNGRASPDCQQNADLNYDVCVGNSINGGAA
MLSFPLSLDASSGLTIAFWVKYDMIGGSGTFLSLSQTLNGDMNSMRATEFFNMDEKNLHV
SLPGQDAEFSYNNMKPNSGRWHAVVLTWRGDNTIQVYIDSLQQLSSSYTPQIQATSRVWV
TVGSMMKTTSMFKGCVSQLNIYDRVLDFSTEMTQLFDTPNFNYPTGVLQGWKDYKTTGDG
VMVRPSRINKQACPENYSGFPSCTTQIVDKKSPEISGCPSNVYTTSINGAGQPSWTEPTY
TGVSSVIFTQRSGSLLSKGRHTVLYEASSSNNNKALCAFTLYINDEFCPALPKPKENGGE
TCSDVGGNWKFKACKIDCQDVNTTNNKIGPNIYTCSPEGDWVWPPSETSYPPCGRIVAEA
NQDITVEVQYPINPTDCSSVQSSLKTRLMEGVNALNTEWQNGLCQQNSCTDVIMNIICNP
GQPTTVNFVLKDVKPELKSASETLKAEEVLAKAVLDQKVLNFDNIVNANVDPHSLLINAR
RVCPAGQTVIDELCVTCTRGTYYDAASMTCMDCPKGQYQDEFGQSVCKQCPSGDTTKDTG
SIAVSQCYDSCPIGQYYSIPNGVCTECTKGQYQNTTGQFECEPCPVGTLTLNTGSTSSSD
CMVGCEAGSRLLPDQTCEKCPIGTYSQEQVCKSCRDGFITPDIGAVSEDNCTVVACPVGQ
YNDNNVCKECPLNQYNDIKWQTSCKDCGARFRTDQVGSTSPTQCIFFCESGYAAGPGNTK
CVICPVGTYKDNNVSPYGACQQCPNSRTTPNNGTTTEAGCSILQCNAGYRADSTNTNCVI
CDYGQYQPNINQLTCFNCTSTQGTRRQGAVQQSECEELCEDGTERVKPGDSCAPCPVGEY
RVKSDVPSNICLRCPEGYVTPGTSSTLQSQCTIRNCTEGYKIENNNCVECPLNTFQPLPY
QTTCQLCPTGKTTISTASRNSSECLPFCVDGQELLSGTCTPCSQGYYKDNAEDKIGMCML
CPQNKTTPTTGARTQTECSLPNCTIGYYIDVPNGKCVACPKGEYQDEKWKFTCKRCPNQS
VTDAEGSTSINQCIYSCFKGYEGSGTSGCKKCGIGSYKPEAGTSLCTACNNGFITKDEGS
ETLDQCNIAACNPGTYLDEVNNVCKQCDYGTYQPERWQKICTSCSAGTVTLQMAAQTAAD
CVTDCPKGSQYNVETRVCDPCPIGYYRDKVSVSQTACQICPAVNVTAGTGAESITDCNVV
NCSIAGFYRNGDKCDVCPRGQYQDEKYQTSCKNCAFGFTTKLIGAPSSQFCYRDCPSGEA
VNEATNICEPCEMGRYRNSSVLDQWTCQLCPANVTTSGLKAKSKSECTVPRCDPGTFVSG
TECKPCPAGTYQSLSVQSRCIPCPDNKITLLDGQTSDANCISLCETGRNNCTQPTTCTDV
PGGFECQCRLPNFGTAKNCSHACDMGYCENGATCRRDSSILCFCAENYRGERCRERVAPS
TASSMTDIIIGVVVGVTAFLLLIIACIICAITRRNRKMRKPIYESYPASTAPPSLYNGSI
SGTNGKAFMPQQDLLTYDPSFYSTGNK
Download sequence
Identical sequences V4BCE9
jgi|Lotgi1|230169|estExt_fgenesh2_pg.C_sca_110104 XP_009045304.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]