SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|230171|estExt_fgenesh2_pg.C_sca_110109 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|230171|estExt_fgenesh2_pg.C_sca_110109
Domain Number 1 Region: 89-201
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-21
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 2 Region: 320-435
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-21
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 3 Region: 2163-2357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.26e-18
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 4 Region: 215-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-17
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 5 Region: 788-853
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 570-639
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 689-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000875
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 510-579
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 45-86
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 987-1052
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 11 Region: 1764-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 12 Region: 1965-2002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 13 Region: 1850-1970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000018
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 14 Region: 920-992
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000778
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 15 Region: 1646-1683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000937
Family EGF-type module 0.02
Further Details:      
 
Domain Number 16 Region: 2680-2831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000166
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 17 Region: 626-685
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000347
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 18 Region: 2809-2981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000455
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 19 Region: 3293-3323,3354-3486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 20 Region: 1684-1720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000782
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 2080-2122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 22 Region: 3153-3303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000224
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 23 Region: 2961-3108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 24 Region: 1611-1643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000298
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 1999-2040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000722
Family EGF-type module 0.012
Further Details:      
 
Domain Number 26 Region: 2117-2156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000746
Family EGF-type module 0.05
Further Details:      
 
Domain Number 27 Region: 719-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000237
Family EGF-type module 0.02
Further Details:      
 
Domain Number 28 Region: 433-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000612
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|230171|estExt_fgenesh2_pg.C_sca_110109
Domain Number - Region: 3543-3585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1422-1545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000628
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 9-49
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000773
Family C-type lectin domain 0.0097
Further Details:      
 
Domain Number - Region: 2043-2083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00447
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1723-1765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00974
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2472-2526
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0167
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number - Region: 1215-1270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.025
Family Complement control module/SCR domain 0.01
Further Details:      
 
Domain Number - Region: 3501-3538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-like domain of nidogen-1 0.049
Further Details:      
 
Domain Number - Region: 1811-1858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.099
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|230171|estExt_fgenesh2_pg.C_sca_110109
Sequence length 3687
Sequence
MESITANGWWANYEPKIQNGECVAVERDGDRFKWAFGSCQEKNTFVCRRKVCSEGSFHCS
NERCIKYDLTCDGEDDCGDMSDELNCSNQCGNVLQKESGEIMSDNFPSPYPMNKNCFWLI
EVPVTYNAHLKFSNFITEEGLDKVQVFVGGMTESTSKLVATLSGDMTSKLPEFTSPNNFI
LVKFSSDASTAAAGFKAMFSAKKEMFPLMKMLTATSSYQTLTAPSYPNNYLGNQDYTWII
AAEQRTSIVTLQIEEVDLKDDDVVVVRDGEDVTSEELLKLTSSNEITSPFIFSSKPKLYI
TLQTRGYNTGKGFKLQYKQGCSIEFVASQGMILSPGFNAGQYPNYANCDWLIKEKEGKPM
TLSFISFDIQTSGDSLKVYNGTSSSSELIGDYKGNYIGASLPSILADTGTLFLTFTSDST
GSKKGFHLEFSVDCPAPNFNSFTKTMPASPSNSPGSEFEVECVTGYHLAAEEFQDPLVTD
KFQARQKITMKCSRGGKWNTLRMPTCEPKYCGIAPELPNGYTVSSTGVTFGMSVTYNCIS
GYSFKETAKTSVECLVSGQWGDMPVCEATQCITPTLAPNSHLTKTEKSTPYGAGVFFSCD
PGYDLIGAPKSYCGPNGQYTAPVPTCKAIVCVVPPIMNGAVDNKDPAEFQISRTFTCNQG
YTLSGTGSVSCGADGNFVGLPSCSDVNECNTANGGCNQQCENMEGSFKCSCNDGYILNAN
KKTCDDIKECDENKGGCSDMCLEMKPGYKCECNPGRELFTQDGVSSYSVMSPESGLREGD
VLRYNHTCVNKQCPTPVMTPNLILLTKMSVFRFQDEIEFACPIGYMLQGSSKLTCQVGAT
WSAAEPTCKAITCAATVSNDLKNEPAFNPENKTVGYMEMLAMTCTYADGSTKMKKQYCLY
NQTTDSYNLEGDDYECGTIDCGKPPNIPGAVYEGYTDGGNTSYGATYAFKCDTLYTIVTS
IANPDDRVINCGVDRKWDAKDMRCEGITCVDPGRPLNGYQNATSYEEGELVMFGCSLDGY
TLDSIYPITCIKDGTGNGLEWNSTVPKCLDTQKPKITGCQELEVDLYSSADVINIPNFSD
NGGLKLMKVTPFYPAADIILSSKDKLLTFEFEDNAGNKDSCNTKISIKDTVPPTLTCPES
YSISIEMETDTTIDNFSNNPAIATDDSGDVTITYNPPTVTADVGHLNIAQPVNVEASDKF
GNKATCTFQVVTSAAPCSPLSFPVAAHTTKTCSNITNGYQCNLTCETNYLFLDSSNAQVF
SCIDNNPWDQAAIDVAGGCSRADVDAKYTVELVYEYKKEDGSAIQDGCEESYKESIQRTM
AKVSSDLQKKCVDTYDNPATVSSDVKSVTISGSSVFASFVIQINGNQASSCGNFFTLDLE
NPTFFINGFYKGPYSGSVCSVINVVVNNNKVSVTNPFTEFSCDRTRKLANFKCLLCSEGY
ENMNLTSGLIDCQPCARGKFTVDGNRQVCEMCSIGTTTYLTGRYSNADCKGKCSDGSVSA
TGLAPCIECPRNTYFVNESYCEPCPGNGITRQSASTNLTDCKDDNSEYDFKNVVNQRLPD
FLLRTLISCILKYTIQSNTRKVTIAVKATDTTSSTGSTKASDCTDAQICQGPNPCQNGGS
CISSQHTFKCDCPTGYYGKVCDKVFNPCSSNPCYNGGVCTQTGSTTTYTCSCPQGTSGQN
CETDLPNCDPYPCGTNGMCQDYIDSYFCHCKSGYKGQNCSETSDVCLEKPCSSPGTDGVC
VKQGTARRKCNCLPGYSGDDCSENIDECASTPCLNRGKCNDLVAEYNCECNEGYNGDQCT
MRDSLCKGVTCTNGMCIEDHMQNTYLCLCDKGYMYNSTTKTCDMIDNCESDPCVSDNTVT
DGCSSSIEGFKCTCKSGYTGSKCQHNIDDCASMPCGKNSVMCTDLLNGFNCTCKEGYEGD
TCQRLKDTCSGSPCKGEGVKKCKLVPNDYICECIPGYTGKNCETNIDDCASRPCMHGSNC
TDKVNGFSCDCEAGWMGDMCEEEVDSCKSNQCVNGAECQNLFNDYYCDCKDNTYDRNCSQ
KENLCQSANPCIHDQPCTETNGLKCMCSSEWKGIGCEIAVDYCAEDVCLHGGKCTPSLFN
YTCECFNGYQGRNCDENPDNCAGVTCPGGATCVDGEDQYFCRCPLGKVGKDCDKDLDTDY
MLLFNSPMKDGMAAFPYPISFKSNQFSITFWVRFWDIDDTGNFLSIFFTESQASTKVTSK
LLNIDHEGLKIMNGTEEKSYTSKYISKHNDGKWHNIAVTWNGETGVLKYVVDSLSDGPIA
DFSTGITVDSNVWVVLGVKYDYQMKKPIMNQGFRGWISQVNLYSSVVDFETEIPQLLKTP
QKVFNDSNPVQLWSDYELMRNVQRVPQSTIQHPKDSCPRGFSNPNACDRKDPGRTQVKVE
KCPDNIVMMGEKRITQATWTPPEFPDSDTVISNYAPDSQFLWGMYPIVYQASSNAGHKAL
CTFYLFIQYDACSKPEDPTNGKQIYLPSAGKFHAASEVGCNDDFEFSQPTPALYTCGLIG
SWDPPRMYNTFVLPPCGAKKTPPKVQVKLTVKYKIKTNDCPQVKDSLIALIRERFVAVSK
KHGNKICGTADCSDIGVVIECIATRRRKRQTGDVTVVISVPLVPSVLNPEGGGTITPEEL
INQLLLGGGGELDFQNQIPGATPITNAVTIVSTPACPEGQTVISEQCVECAAGTFYDVSS
KMCKSCPINKYQNMAGQKECMSCTAGLTTENMGSEKVSDCKDDCPLGEELTGAGQCQKCP
VGKYRSADDTSCQPCDAGTTTAGEGTTSKKDCNLGDCQKGYKRTSGTNCEICPVGSYQDK
VHQTECISCGGSSYRTDQEGSKSKTDCKFFCPDGEEQLDKNATVCTKCGIGFHRNSSVYP
YQICQPCPGNFKTPKEGAVSDTECTIFKCPAGKYPVMDKCEPCPLGEFQPEAEKEKCIKC
TGDLSTRNKGSTNESQCEIFCPDGEEQLDKNATVCTKCGIGFHRNSSVYPYQICQPCPGN
FKTPKEGAVSDTECTIYKCPAGKYPVMDKCEPCPLGEFQPEAEKEKCIKCTGDLSTRNKG
STNESQCENYCVSGEEKNANGTCDTCQRGYYKDNKEGLFGECNLCPIEFITLGTGAKQAS
DCNVKNCSAGSKLESNQCIDCPVGFYQEEKWQTTCMKCDAEKTTENKGADRKELCILKCN
PGKEDVNGTCTDCQVGFYKSTQAAEKCKMCPTGFITIATGSTSDTDCKVAACTPGEYRDD
ALNSCKKCTYGDYQPMKWQTECLSCGAGNTTYVKGADDISQCQADCLVGQENINNTCSPC
EIGFYRDKVDKEQPRCLKCPGNKITAETGATKAEDCTVTACVTLGEYLVEATNQCQKCPK
GQYQNEERQKSCKNCPTGKTTENEGSSKPNDCKTDCLAGSQYNEGAGKCELCPVGQYRDK
TTWGCQMCPDQLSTTQTGAVSQSECTKSPCKAGEKFDQTQKKCVACPLNTYQPDANKFEC
ISCTRGESTSSTGSTAASDCQKKCSDATKIDCHSNAVCTNVATDKGYTCTCTDDYQGDGV
NCTNKCLLGYCGNFGTCVPDSSPIQCQCRENYEGAQCQSRKDPSVSGPLANKTIIIGVVT
AVALLLFIILIIVCIIVRARRRHQKRKPFLNEFDDRSVGTRMSFQNYDPYGSKPPSMGGQ
RLMLPSNVEKMYDNPVFREDDPAVYRA
Download sequence
Identical sequences V4BCH6
XP_009045309.1.39240 jgi|Lotgi1|230171|estExt_fgenesh2_pg.C_sca_110109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]