SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|230443|estExt_fgenesh2_pg.C_sca_120248 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|230443|estExt_fgenesh2_pg.C_sca_120248
Domain Number 1 Region: 2056-2124
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000159
Family ATI-like 0.025
Further Details:      
 
Domain Number 2 Region: 2448-2494
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 2227-2275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000479
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 207-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000068
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 5 Region: 1724-1774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.037
Further Details:      
 
Domain Number 6 Region: 144-258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000392
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 1449-1492
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000493
Family Fibrinogen C-terminal domain-like 0.0045
Further Details:      
 
Domain Number 8 Region: 2523-2574
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000559
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 9 Region: 2264-2308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000795
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|230443|estExt_fgenesh2_pg.C_sca_120248
Domain Number - Region: 2334-2369
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000559
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number - Region: 445-498
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00142
Family Fibrinogen C-terminal domain-like 0.0074
Further Details:      
 
Domain Number - Region: 2394-2430
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0025
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|230443|estExt_fgenesh2_pg.C_sca_120248
Sequence length 2658
Sequence
MPISQSVGESILRVVIFCHIAQIKYPVESVETLYFWKIFVWTESPYRAGNCSEAFVICDG
LAECVETKSNYSFQCICGEGSMGDGFKSGTGCFFENEPCTKKEDCHKDAYCDLGGENICK
CNEYYVGNGKDICLDIDECKSSPCAPEGGNCQNQIGGLPTCSCDIGYEGDGLTCTRICLF
DDDCFSLASCVNKDCKCNSGYEGNGFISCTDINECEVNPGICTAPAVCKNTQGGHTCGCP
NGYSGNVGKCTLLPKDCQEIFENDMTAKSGDYFEIDTDGADPIDSMMVKCEFRDDVGITI
MEPNTIKPSTVGSTEISISYKPGTIEQVKDLVSKSAFCYQSQWLECSNGFDLFKDGLFYW
TDGAGNSYKTWGGSGEDGQCPCGVLGYCEQGVPCNCDGTSTTTGHDFGKIINGSMLPIAT
LQFNTASNGAAKYKVSEVVCASKIIDILKDCDQIKMDGFEENGPQYIDIDGPTGDLQPTL
VHCDMTQYDHVGLTVMPHDIKEPIIPDSGGPIDLTYLTPDDVIQAIIQASAFCFQNIRYE
CRNAPITFEGEQRVYVKAGGGNGTQLNYFPGGKQREGYCGCGVTCSCVNTNYTCNCDITD
NVTRYDIANHTIKEDLPIKSFYVNLSLPDSYSRIIVGPLLCSEQQFGIEPNCEKYRNIGV
EDPYTYLIDPDGPKDPEKPTEINYEPFEVECQFNANPPQGVTIVHHDQEGPRDVTSDDFQ
FEMVYKNVDKKGQIAHLKDRSTFCGQSLDFACTNTKLHNGPEEGVTWKDIDSNSHSYLSG
GEAGDTGCRCNVENNLNCAEGDKICNCDADAGGNYNDDGELGNITHLPVSSLDFMDIRND
IGSLQFTLGPLKCFETFTTCYDMEKFLKEQKKLGEAKLENGKYTIDPDRSGDNPPFTVTC
EFPFTVVSTGPANLTGPDPGSTECYTVEYFDFDGNALTGSQVAYLVSDSDYCTQKLEYEC
KNAPLTGNVNYTTCDGRPQTGWALSSGYDMCSCGLTGTCVGGLNEKCNCDTVNGEKDEGT
IYNSTRLPVCEVCITVDPLGGNNPPSPGGVRSASYDVGMLKCSGAGFVGEAHCQDLRVTS
TTSGVSYIGDKEAGSVVPVYCDMISEPRIGIMEFRLNETTYTIPATQGIDISPVYFGYGK
EDMERLINDSYYCTQEIFIDCNSGALDLSGINGWYSRAGDPQDSWGGNIGKTLKCEGTGS
NCNCNKAGAQTDGGILGDKALLPISRVVLEPHSSERILRIEPVKCYELRPDCYQIMMSGN
TKTPYSEDRYVIDPDGPDGVDPFVVTCSFNSEEDNAITEVPVDSGANNPITGKVADFGFP
VPITYKDATPEQINVLANQSPFCHQGVEYECTKTPINGSVDYRLYDNTIATGFGTGYDTN
SSVCPCYALGYCDGFACRCDEKLSSKQRDGGEITDKNNLPITVVNVGGQVEAGASANVKV
DSVRCEKRPIDLPENCEEAKVKGYKTGEVMIYPSSSLDPFFVYCDMEINPGRGTAVVLPD
IEPDQPVAYDGVAVNVTYKGLTDAQLQALVSNSYRCYQPVRYNCRKTNFVGGDKFSWTSV
DASVNKYFGAGSTGECTCGKENKCAGSGDKSEMEARDCNCDMGDDEDRIDAGILSVKEDL
PLRSYTFLPTGLDGSSGNITIGPLYCGQNTINLDECEQGFHDCHPLATCSNLHAGYSNPS
SRPGFKCSCTAGNRGIAKPQLFVNGRQCFGDFLCTCNKGYEKMEKTVCRNIDECVEVQYP
NNCDLNAKCFDTEGSFYCKCKRGFRGEGTNGTCEGVGICACFGDPHCISFDNKWLDFMGD
CQYVMAQDGCDGSERTFAVWTHNWDMNRDIQGITWVKDVTVVIGDTKIFLGPDRVIRING
REFLGYRKDGISVDDNGREVVITADFGLEVAWDGGDEVEIFLDKSYVGKTCGICGDFDSD
EDNDWRIGDYCTAAKGQITPNGNIFGHSWVVQDYLTEHPTCVADCNAAPTDYSGCSDTLY
NYYCDRVFDPEISPFKTCLEVMDEPLRDRLKSTCLFDICQVSNDIELGMCASAERLVNEC
NKNLDTETGLWRKLGFCEIQCGKNQEYRTCGPRGYPAKTRQPLCYDIRTHSPIHLLEYCA
EGCYCLPGYILEGKDCVLPSECGCIADGVYLSVGQTFINDDCTSTRKCLSGGNTSDITIA
CSQFATCGLDTVNAVFGCNCNDGYKGDGINCGEDNCYNVTCGKNMECENAICQCKKGYTG
DCNNCEDIDECATQTHDCIHIGQNCTNKDGGYECACIKGYVPYGHYCLDIDECEAGFDNC
GDHSECVNTHGSFECSCCAGYKKSGDNCVLDGTSATNGAKCCSCAGEGCSTDVKVCAENG
TTYPHEKALRIASCRNDFFVDISYYGQCQADCTGVICEKPYEVCSIDPLYNKAICACPKC
DGSGGPVCSSRLVLFDSRCEFERIMCEIKDNTTYIEEDVTLCDKVLGEPVSPWTAWSDCS
VDCGAGEMTRTRVQLRARTTYELRVLPLLETAICYGNCTNGPCFGFNCTVYGEVCVPTVD
NTPECICPNCTFREDDPICGLVGDKQSTFKNRCELQKKACEVNQKPHVLSESPCGALPLN
CSMFSKYQDLSDGECFSGPVPIGTCEGGCGINPDYCCETQTMGVVEYDLLCNNGSTLHRQ
VPSITSCSCNDLGHTTPA
Download sequence
Identical sequences V4AG22
jgi|Lotgi1|230443|estExt_fgenesh2_pg.C_sca_120248 XP_009046459.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]