SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231103|estExt_fgenesh2_pg.C_sca_170229 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231103|estExt_fgenesh2_pg.C_sca_170229
Domain Number 1 Region: 102-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000928
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 32-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000218
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231103|estExt_fgenesh2_pg.C_sca_170229
Sequence length 1697
Sequence
MRKIYTLVTKDCFLTAASGRSGAILDSISKFQSAAMICDRATREHSNYVIWKTPDRNIIT
SKTQTDRIKISGPYLIIHNLKESDRGLYKCALLSKLPYTMSTHDCRSHLCLNGGQCIEQS
HIGVSNSLFVCICKSGYGGVYCAEEIGLRSAHIIGIVFLVITLGTAKVLILYFCCRFRKS
VDFKILKEITKEDGTKKSVVERLKSALLCCKGPNDEVNVQKTNVKSKPPQKTKNVPKVMK
ETQTLPEAVLTMENNPSAKKGQSSTSRNTLFGVRSSLKDDINNLLDGVTGAIKKGSTNVR
SSKPKVVKDTDNSLDNIIKGIKKHIPCTSKEKSPSAFRRNTLTVGGTTTGSIRNARDPST
AMNNVSIDSNSDTTSIHDTDSEYDIENKRSKHSFGETLYYPIPAVKAIPMTTDNKPDDNS
KKTSEDLNNSLLDHARVILSSGTNISSQNEGPGIKTDNSNIQLNFSVSKEDAVGKKPEKL
YSRKEDIKVSDKSTKSMGNAIRGLGEIEMCTTGDYELKSVPFKITSLSDRSAENKKVYQV
TPHPKMLQSKPLAVDPKENNQSEIGKKAVADSDSERAQNAQVKTIEFSETVNDRARQTDS
ETPSAKFEASGSISDDPKKREISSRLEILSDEFKKIDDTVYCNTHKTSVFIEALNNIGHY
IVSCEHGFMPMVIDDEMFSICCREHHLRISDLLDGYTAGYSKGQHEKSSNQSNLENSTIP
SHTNDKMLQSPMEEVKSMHISGCDKERFISMDDFFIKSITITPSSSVGSVESNKSYQISS
RSKPIQSPKLTEVELYRAPLSPSPTDGFNSVPMVLPQTEEAKSILTSEHDRGSFNSAPIT
SDFLLKSGIITPSTSVGSIKSEESYQTLSKSLLSPQRTDKVELCRAPLSPSQTGGFKSAP
MVPPRTEEAKSILSSEHDKGKLNSVPINCDFLLKSFTITPSTSVGSIESEKSYQTSSLSQ
PLPSPQRRDNVEFYRAPLSPLKTDGFISGPMTPPRTEEAKGSLNSRSFESKTGDFLLKSI
TITPSASVCNVKSKKSHQTSTEILMSGDSAQPKIDLLASSHSDSIYSAASSLSRTGGAKN
STETKTNCQSGYERIDRSNNWDVCERKVGEQVDKEIEEDFQNLKKADPQLLSQFQTVSTP
KKGDKISLIAQELSFGKQEIHDISNVSLKSMPNLDESQYFNPIENISEDSQNTTKSTDNG
SNDMSLLSATEKGQSSVKDGTGRYGGKESVDLSDANYTFSPETTENCSSITNPGLSEKKP
ETSANLSKQISINSKTTIISSSDSKMNSSPQGLVAISRHSSLNELEDVCAVQGNGESCAK
SDQLASHSNDTSANDLTERKAYSADNNSVDISLSTSITVSSNAPHSNPLFDPDDNSSVHT
VGSVKRLSTLVSPNLKPVSPLNLDKSNNVTGEPNKQNISHLKIDKSSQIPPKVSNNIFPG
NMSYKIFTDPLHESMLIESAPVTERCTKYSQYIKQNTDSTANEGIDEDTMPQERDLTETN
QYFPNTITEPSLQNRDNDSMSRSTSFYSVDDTPMTLPYVTNTHDKNTQYSSEIRNSCVAE
VSLETKTFAVTDADEVYDEYFNMSKFKRIMCPIPEEEDSLDGSVEFKSPYTSTTEFESVI
DSESNILRPSASDYKSPWPSEYWLLKNRGEENDNVSDETWLYTESNNSCLCDGNERASSP
VWSSFYQDDDKPNPAQF
Download sequence
Identical sequences V4A6F1
XP_009049975.1.39240 jgi|Lotgi1|231103|estExt_fgenesh2_pg.C_sca_170229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]