SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231995|estExt_fgenesh2_pg.C_sca_240205 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231995|estExt_fgenesh2_pg.C_sca_240205
Domain Number 1 Region: 1300-1428,1455-1521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-36
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 215-344
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-29
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 739-852
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-29
Family Cadherin 0.00047
Further Details:      
 
Domain Number 4 Region: 326-438
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 431-535
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-26
Family Cadherin 0.00095
Further Details:      
 
Domain Number 6 Region: 636-735
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.00098
Further Details:      
 
Domain Number 7 Region: 1543-1724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-24
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 8 Region: 537-648
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 846-964
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-21
Family Cadherin 0.00073
Further Details:      
 
Domain Number 10 Region: 113-219
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-21
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 1234-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000384
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 12 Region: 956-1058
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000357
Family Cadherin 0.011
Further Details:      
 
Domain Number 13 Region: 1857-1897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|231995|estExt_fgenesh2_pg.C_sca_240205
Domain Number - Region: 1768-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1725-1761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231995|estExt_fgenesh2_pg.C_sca_240205
Sequence length 2762
Sequence
MHFIVLHSFYDDCIASDQNIISLTDYLPNTYQQCSIIVDIPESTGYVTDNNIIRSVSPRC
FNNQVISFAFKVLFLCPNHPIFYQPYFLNIHPKENPRSSSAPSKSWRRKRATDNHAPVFD
ERKYVKHVKEGLEKGVIVGTITAHDADQGDEGMITYSMIPERDERSANMFAINPRTGTIN
TTTKLDRELIEIHFFRIIATDKGRDSKKGYTNIQIIVDDVNDHHPQFEQQNYVRNISENQ
DVDTNILTVQATDLDVEQNADIRYSFVNPTRDFLIDPLRGIITNLVKLDRETKSSYVLIV
QAMDQGPINSRKSTTSTVSINILDLNDNKPQFSQTSYLVNVKEDLDVFSRPVILNVSATD
KDQGLNKEIRYSLTGNVMDTFQIDSLTGQLHVIKALDYESYREYRLNVRAEDSGNPSQKN
STAILVQVIDVNDNSPQFHGDRYMESIDEGAETGSSILQMVAYDLDSGKNKEITYSILNK
PAYMPMLIDPRSGWITTNGVLDREQEARYEFTVQAQDNGVIPLSATTSVVINIRDINDNS
PVFRPRIYETLLSEDSRIGAIVTSVTAVDKDDGDNGHVIYSIASGNTADTFQISTSNGLG
VIRLQKKLDARVQNRYALSVTAKDPDGNLDTTEVFINISDTNRFLPEFQGTPYQFDVDEN
VKVGTSVFKVFALDKDRGENARITYSFDGAVSDFIINPDTGQIKTSQELDRESGPAYTLT
ITARDNGSPSLIDTTDIDITVNDINDNRPEFSEVVYTGSVKEDILVGRKVIQITATDRDK
GANGQLFYTFEGGDDGNGDFSIDRSLGVIRVAKELDRETVAHYNLLAYAVDEGEPTLSSS
VVIKLKVEDINDNRPQFEAETIEVGVPENSPRGTTLTKISAVDPDEGVNALVEYNFVGGA
DVESFHLVSKGGEPAIITTKVDLDYESDKKQYEIILRAASDTQFSTATVLINVQDVNDNA
PILKDFTIIFNNYLDHFPSSSIGRIPAFDPDIIDQYRLDYKFISGNGANLLHLNQNSGKG
EITLDPRLNSDVPRNGTFVVSVSDGKNTVKATCRLYVRLITQNMLLNSVTIRLNKMTQTA
FLSPLFKFFVEALATILKTDENHIYVINVQDDTDVTAQILNVTVSVRQTFKMIQGENVEV
FYPSDHLQELIYLNRVLLANLSTLQVLPFDDNLCMREPCTNFEDCRSTLVFGTAPDFIMS
ETMLFRPIHPKNGYRCECPQGFTGMNTTIFCDTEVDLCYSKPCQNGGSCMQKENGYTCLC
SPNFEGVNCEISMTSKYDAETCPDDLCRLPSYCVPLIDGGFQCKGCPDTEDYDQFCRLRT
RSFSSRSFLSFPSLRKRHRFKIEMRFATQKKNGLLFYNGRFNEQHDYIALEIVEGQVVFS
FSLGGSVTMVTPNVVNGVSDGEWWKVKVEYLNRQATVTVGEKCDTEISVRYGNALGNYSC
AARNTHNLPTKCDNPVEVCHRLLDLTGPLQIGGLPGLPTAFQVQNRNYIGCIGDFYIDKV
LLDLNSSVVAVGTENGCSMKKQRCRNSPCKFGGKCREGWDDFFCDCSEKTGGKDCSQVIE
SSRELSNNGYLTYTNFTFPKINFPWYTGLAFRTRNSNGTLMQIVLSDGDVRILLLNGYII
YIYNGKVVVFDVTKVNDGQWHYFESRWYPGQLQMFLDYGQRKMVVDMPSTVLEKVIQVVY
VGGYHTDNSPIMNYFKGCVKDVRVGNLDDSLLSKPQETNVRLGCSSNEVCTSADCGTGQC
IEEWGLHSCQCPPGTVGPNCVEVCTGVNPCQNYAACKFPQGNEETYTCECGRRQNGRYCE
IISPKVCPISWWGDPICGPCNCPTHFGFKSSCDKNNGSCICQENHYRRPGEHKCSPCDCY
ERGSRSLTCNSVTGQCDCRNGVIGRRCDQCSSRFAEVETNGCNVKYNVCPRNRAAEVWWD
RTEYGVEAVQDCPYDANGDAKRECYVCEEGKSCDKEEGWQEPDLFNCTNKNFTRLSSVFK
SKISNTYTAKNSIDRLVEATNTTYHIFGGDIVMAYNVIREVLLYENKLQGLNLTSEQHST
FIQRMLIAVSNITKLEYEVLWDRVNSVTGGAGELVNQFENYVETLTKSMEPAQSTPFDAI
ADNMVFAVDWIRKGNSSNNYIPKYDHIAKKGTFDDDTRVKIPPSLLYHTLGSSEMNGKIY
VGFIMYKTIGNLMSKNYSAEIRTTHSIRINSPVVSLVIVNEGRVKSGNLKYPIEITFRQL
NTTNRSNPLCVYWKTDNNGYSYWSRNGCEVSDRYSKSQSQYVVCSCHHLSTFAVLMDVSD
KEYDEMASVTVEVLTYILVFISLMLLVVAYLILLCFKRLQCNWNSIHINLIVVVFVAELA
FIIGINRTKSELTCRLIAITLQYFYMAAFSWLFVEILHIYRMLTEIRNINYGSMKFYYLI
GYAIPGIIVGLAVGLYTDGYGNSQFCWLYTSNGIIWSFAGPIAMSTLISVLVFILAVQAS
LLEKTHVRDIQTVRMGLMCSIIMLALLCLTWVTGLISVNYGIKALHYVFACFMFAIGAFF
FVTQILLQRKVRLQLKKAWYRIRGKKLDIDENLAGTRSTVVSRSALAYRHESFSDSGLHR
INIGISTTSTTSQSTSKSSGIRKDTYLRSTSSSTSGHVPTGPIYPPNTGIAPYGYDPSFN
HNKDMNGKILAKTGQDSDSDSDGSDNNSLDLASSHSSDDEEDMDTNRWDQMASSEIVEKA
KEQLEKQRKEKDEMKNKSPFINESVWPGEKTRDVEGRLSSQRPDVTMTSADSTAGVRLQF
ET
Download sequence
Identical sequences V4AQB1
XP_009053675.1.39240 jgi|Lotgi1|231995|estExt_fgenesh2_pg.C_sca_240205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]