SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232718|estExt_fgenesh2_pg.C_sca_310081 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232718|estExt_fgenesh2_pg.C_sca_310081
Domain Number 1 Region: 597-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 142-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000489
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|232718|estExt_fgenesh2_pg.C_sca_310081
Domain Number - Region: 565-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232718|estExt_fgenesh2_pg.C_sca_310081
Sequence length 805
Sequence
MGAWRFLLVTCLPFVVYCHNHGVFHQDNHQIGRNQEPIVTPEYQIPSFPHDGRRCVSFAR
QTKVVDIQLPYLCLPGKPGGVPIPQRNDKQTATTLLAMYWNGWRVCKHEVKMPMNNYVKV
STCCPGWEAGPTGDCTLRKQEPSFHSPCKNGGFLAPDSRVPRCVCPPGFKGLLCQTPCPM
ALNRLVAGRLSNSPFMKHILPRMRNLINIQTKNLMRGLGPRNIPLGNPYMPTMMRRTNPF
SVPGIMGASMSKPMTLLNIMAMKELLKPRRKSVMRISKIIPLGVMSKPVINQQTPQTSDT
TDKSNPMYRVNILDNSLPNQNQNLNQEDIPQHQETHPATQPQPVNVHSLPPQYTPQEFPQ
PTQQQIPNFNDKHVNGETSCKDILKMGITRCVQEAGIDALPEDIFESTSPQNEAVVQQIC
SLRGNQLSSCIMAGQNACGNGIQISITRRMLLEFISSVGQKCNQPSNPIPPVVNLASPQT
FDINRMGPMYPYVTPHASMVPLPPASLRSFIGKNPFLPLQQNRIMPVPPIGHSEPPVGQH
VPIRQPATNLGQSVPPMEEPIQTIECFNNGYAVMDNGQQVCECPEDFSGDNCEIAVCESE
CMNGGNCEAVAGTTMCICAEGFIGLQCEEAEPELTEADITALVDDSVLAQDTSVTGPEDV
SQKVIDSYPIPHLPKESPEGFLTTARPLPVEEKVAEMPQQESLKPIESKEVKKLNQEDNS
EAVKTEILKADEDFNFDDYPLWMILSVSFGALLLVLLLTTCVCMCVKRRSRRVVTVTTKA
AALPEKSPVKDNIYVVGIPPPVYED
Download sequence
Identical sequences V4A935
jgi|Lotgi1|232718|estExt_fgenesh2_pg.C_sca_310081 XP_009055976.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]