SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|232739|estExt_fgenesh2_pg.C_sca_310121 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|232739|estExt_fgenesh2_pg.C_sca_310121
Domain Number 1 Region: 694-853
Classification Level Classification E-value
Superfamily RUN domain-like 9.68e-35
Family RUN domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1008-1190
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-27
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 859-958
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.58e-16
Family Lipoxigenase N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|232739|estExt_fgenesh2_pg.C_sca_310121
Sequence length 1195
Sequence
MTLNVAASRFADYFVVCGLDVSSGLEPDRLAGGESHHIEPLARSYKSKVLAHFPETVSWN
PFDKEAVGMLCLPKGLQFRTQRDSRNPKFHSFIITKEDGSRIFGAAYVFYEEVTNKQICA
AMQTLHAMHQAQHSPALKPQFPEIYSPDSPILMKKIIPSKEKSRVFDIHKDKLYVTKCIC
LILQLPFVKSCKKFLKQLHEAVNKPSRASLPLESYIYNILYDVPMPPPGRSLKFYGVMSP
IFCQRPSMGELPLFDFSLWELCKLLGIDNLLLIFVSVLMEHQVLLYSADYQKLMLIAEGV
GCLIFPFTWQHVYVPILPASLQHFLDAPVPFIMGLHRSNDERPELANMCFVDVDNNSVEV
PEDLPFFPHHDELKEELLQLLNIYQDIFTPPIKSGTTITSSPLRNTMLQQSEAWKKISSI
AKKTGVWEGYGEMSGEEKCMDADKPIEENKKDVDRMPVSEVNDLKFNSAIREIFMNRFVH
MFSSYESFVIQPSHDLESWINNRETMQNFDKASFLSDQPEGDLPFLSPFIETQMFATLVD
NKIVSQWEETDPYLGVFEARIRNVNDVLGEVRTPTYSVCTTITDTEVFPEKRATFIDHTS
VKPQELSSDLTQSDIKPGFFPVLNKVFLNTEIIANKSKTRENAKWRRKDRVLQHAEHLQL
NSDQRERYIQEARTKNRQPKLSEMSAAGMVQTNWKFVETLLKECKTKTKKMLVVKMGREA
VELGHGELTITGVEENTLIAGLCDLLERIWSHGLQTKKGKSALWSHLLSYLEIEEKVQQM
GDIRTDVGYARAWVRLALEKKILSSHLKELLSDADLLRSLYKRYAFLRCEDEREQFLYHL
LSLNAVDFFSFTNTFVNTMINYKVLIYPSTKFGCATTTANPWISIAGQLGESGVLDIPRG
CLEFNFQHKNLGILTTLRIGHDNSGMSAKWLVEYVLVRNEVTGHTYRYNCGRWLGKGVDD
GSIERLLVAELMPHKKETEGELSGVHTPPRSPATPRKQIDPGTLNTPAIQEMLGHSVNNL
VKHFYKPAKERGSLTFLLCGDRGLVHCMDLVFQYGFRSSRLFRNKMFIWDYLGKFFFTSL
ILQYNTLSGVTRRPLTEVARAGYWLFCNLLNKINNATESIGKDGKFQIFICVGVRDHCLQ
KWLPLMVNTPVTGQMYEANSFLRDPRLTKFLVHIIETLNEFNIVLESSVLQGLNI
Download sequence
Identical sequences V3ZPH4
XP_009056012.1.39240 jgi|Lotgi1|232739|estExt_fgenesh2_pg.C_sca_310121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]