SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233075|estExt_fgenesh2_pg.C_sca_340150 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233075|estExt_fgenesh2_pg.C_sca_340150
Domain Number 1 Region: 98-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000829
Family Cripto EGF-like domain-like 0.0048
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233075|estExt_fgenesh2_pg.C_sca_340150
Domain Number - Region: 65-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000235
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233075|estExt_fgenesh2_pg.C_sca_340150
Sequence length 199
Sequence
MDISYLTRCVLLLVGIILTTEFVESKKETPKWIKRSLKRERIRHHHGGFMKKQSSESFDN
PQAYKATCCKNGGRCIMGSFCHCKKNYYGRYCEHKSDNKNCGKFKHGVWLKSGCNLCRCF
DGVLSCIPRAYSGCDDKPVHIRDKYNPDDEVYVFPTETEDKVEEDSNYYDVTPSDAVNIS
KSWISVLSAVVLSFRIIYR
Download sequence
Identical sequences V4BUB3
XP_009056775.1.39240 jgi|Lotgi1|233075|estExt_fgenesh2_pg.C_sca_340150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]