SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|233842|estExt_fgenesh2_pg.C_sca_440112 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|233842|estExt_fgenesh2_pg.C_sca_440112
Domain Number 1 Region: 77-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|233842|estExt_fgenesh2_pg.C_sca_440112
Domain Number - Region: 225-274
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00902
Family Pan module (APPLE domain) 0.069
Further Details:      
 
Domain Number - Region: 30-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0364
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|233842|estExt_fgenesh2_pg.C_sca_440112
Sequence length 289
Sequence
MLSIRVLGVFAVIVVALVLVESDVELCEDDVNVCDGELPANAMCSGENNKTKRCQCKKGY
RMSLDIDCKSNGSVFSCQDIDECATNNGSCEYKCQNEPGSYNCSCPEGSELQENGLNCGP
SEPAVRCPQGVNITNSDDVTESRIFDEDFSFNCTLIGVKGILRCGENGTWTEKQACPSVR
KDSYFILFVNAVKITVPDSNCSRACAVISTCGYTYLSNPAECSYYPIPVLFLNPLSNPSL
PQCIQKCQEDTKCLTMSYKDTCILFSANETTVAASFYIVITDGGIIVSF
Download sequence
Identical sequences V4BND1
jgi|Lotgi1|233842|estExt_fgenesh2_pg.C_sca_440112 XP_009059025.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]