SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234614|estExt_fgenesh2_pg.C_sca_530062 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234614|estExt_fgenesh2_pg.C_sca_530062
Domain Number 1 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000123
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 348-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 503-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000602
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 781-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000166
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 966-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000295
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 425-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000529
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 1233-1360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000549
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 701-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1101-1248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000111
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 10 Region: 79-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.03
Further Details:      
 
Domain Number 11 Region: 928-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1004-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 590-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 741-777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000296
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 853-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000382
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 469-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000687
Family EGF-type module 0.027
Further Details:      
 
Domain Number 17 Region: 890-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000766
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 627-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000821
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 19 Region: 664-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.032
Further Details:      
 
Domain Number 20 Region: 816-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000657
Family EGF-type module 0.019
Further Details:      
 
Domain Number 21 Region: 1366-1399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000734
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 22 Region: 39-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 23 Region: 1042-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000164
Family EGF-type module 0.01
Further Details:      
 
Domain Number 24 Region: 311-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000219
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|234614|estExt_fgenesh2_pg.C_sca_530062
Domain Number - Region: 542-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234614|estExt_fgenesh2_pg.C_sca_530062
Sequence length 1400
Sequence
MDKKYMFLVFVFLLFQVNSQTTPKPYRDNCVDYIEPFIQVFCGDPVNPSSCILRTWVCDG
SNDCPQGLDESEATCKGGNPCLTGPCKNGASCYPFSAITNVSVAYYICACPLGYSGFLCE
IAPPTTQITTQPSSTPSPTSPTSMTSSTTTRSTTSDSTTKTASSTASTSDKTVSTSTTGP
STSTTSSPGSSTRVTERSTKVNSSPTQVTTSSTQVTTSPTQVTTSSTQVTTSSTQVTTSQ
TQVTSPTQVTSLPTQVRTSPTQVTTSPTEVTTSPTQVTTSSTQLTSPSAQITSPSSRSTT
QATTTTESGSVGSCSPNPCINGVCTQLRNNRYHCNCIPGYGGDRCVQTINPCSSLPCLNN
GQCQVINNQFNCSCQAGFTGRQCEIDIDDCQSNPCLNNGTCTDLINSFTCSCLTGYTGQK
CESMINYCFSQPCLFNGVCESRLNEYVCVCPANRAGANCERQQLCTNNDPCMNHGICLPG
NLPGSSPTCVCLQGFTGSFCESNINECQPNICGQNGKCIDGINKYTCQCSPGYTGDKCSI
KVDPCLSQPCQNDGYCCRQGKQFCASGLADGYYECYCVSGFTGNNCEMRVNECLLSPCKN
GGMCTLRNDAAYCTCSLTFTGPTCDTPNPCGSQPCFNNGVCQTVGSSYSCQCSEPFSGPD
CREIKMCEKNLCQNGAACSLVNGREVCICTSAYTGEFCESYLSCSSFPCQNNGQCINLIG
QSQRFRCSCAVEYTGSLCEAVQPCATNQCANGGSCINKADSYECKCAPPFSGPSCTRRLF
CQDKPCKNGGLCVETATGYRCVCTFGYTGGACETFLSCSSSPCQQNSACINVDNSTYSCT
CSPSTTGKNCESILPCASFPCLNNGQCNNIGLTDYSCQCPTQYTGKSCDNYLPCWSSPCL
NGGNCTTVGFSYSCQCPAFYVGPTCSRYNPCGSSPCMNNGSCFLNGDNFLCICDGGFSGQ
RCENSLLPCSGQPCLNSGTCIVNGSSFTCRCPANFTGSNCDVPVPCGSSPCLNNGSCSTN
GLQYSCRCEPEYTGVTCETRLPCAVNPCINGSCSNINTTFYGCICDPGFTGKNCDTRLPT
CDQTNCINGQCVIVNGEPKCQCTTGFTGSSCETQQSPCDLKPCLNNGICERNGTNGYRCN
CPLRYTGAKCETEVKACDSSPCLHNGTCTNTANSFTCNCSENYSGKLFLFFIAMSGKITT
RIQCEIIKQPCDSKPCLNNATCIQTGTVYQCLCLQGFTGKNCGTKFDPCSSNPCNNGVCS
VRNTDFFCSCSPEYTGKSCETKLTNCNQKPCQNGGTCFTDEFGIFCECPSKYEGLYCQYI
VSTVDACTPSPCLNNADCWVVENKPVCDCPNGFTGSICESRISSIGCTPNPCNGGMCFEN
SNGEFNCICPPGYFGTTCTN
Download sequence
Identical sequences V4BHL0
jgi|Lotgi1|234614|estExt_fgenesh2_pg.C_sca_530062 XP_009061000.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]