SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235547|estExt_fgenesh2_pg.C_sca_660064 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235547|estExt_fgenesh2_pg.C_sca_660064
Domain Number 1 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000415
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235547|estExt_fgenesh2_pg.C_sca_660064
Sequence length 529
Sequence
MRISHTSEERLGRDMMGEINSLKWSEIGGDSPLRSEIARKQTLSATIISSMYKRYQLFLF
GVVYTIGTTSGDFVCLRTGVGCTDDGNKCEANGTCTCTTGSGYDCGLNAETLSNECTESC
QNGGSCFKKDSTVGCYCTTDYYGPFCQFKRVSVKCNESGMVVNVNPHGTFQGNIFVFGLQ
NNASCNLVNIPANQVQGADPGWKGLAQYLPYNNSCGDAQISVNDTMGVYEFKIVTAYNKL
LVTSLDELITAKCFIQTGGQISISSDVELSNYGSDLKSTGSVEETFSPIEFKLLTNNTEK
KSVKLGDVVSLQFQLSTQSDLNAIRLESCVAETNQGNSLSLVSNGCRTKDAEQLISDEAS
GEPERSGNDSIVTFKITAFKFIKSNQVNFRCIVMACKDGDTKCEKQCITDSISTRRKRDT
ITVRKQVMRSLIITDGTNLDSSVDEADQCLSREQLNNLSYNDDSSPTSCFELTEVLAVIV
TLSVVLVLIMITVTLLSVRYIRNRQSKVDNLHFKDDRPTFTIPRASVAT
Download sequence
Identical sequences V3Z5Y8
jgi|Lotgi1|235547|estExt_fgenesh2_pg.C_sca_660064 XP_009063152.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]